Anti-NLRC5 antibody - N-terminal (ab178767)

Overview

  • Product name
    Anti-NLRC5 antibody - N-terminal
    See all NLRC5 primary antibodies
  • Description
    Rabbit polyclonal to NLRC5 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human NLRC5 aa 89-138 (N terminal). The exact sequence is proprietary.
    Sequence:

    LLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKK


    Database link: Q86WI3-5

  • Positive control
    • Jurkat whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab178767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 149 kDa.

Target

  • Function
    Probable regulator of the NF-kappa-B and type I interferon signaling pathways. May also regulate the type II interferon signaling pathway. Plays a role in homeostatic control of innate immunity and in antiviral defense mechanisms.
  • Tissue specificity
    Expressed in spleen, thymus, lung, brain, tonsil, heart and prostate.
  • Sequence similarities
    Belongs to the NLRP family.
    Contains 26 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Caterpiller protein 16.1 antibody
    • CLR16.1 antibody
    • FLJ21709 antibody
    • FLJ39711 antibody
    • NLR family, CARD domain containing 5 antibody
    • NLR family, CARD-containing 5 antibody
    • NLR family, caspase recruitment domain-containing 5 antibody
    • NLRC5 antibody
    • NLRC5_HUMAN antibody
    • NOD-like receptor C5 antibody
    • NOD27 antibody
    • NOD4 antibody
    • Nucleotide-binding oligomerization domain protein 27 antibody
    • Nucleotide-binding oligomerization domain protein 4 antibody
    • nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 5 antibody
    • nucleotide-binding oligomerization domains 27 antibody
    • OTTHUMP00000164675 antibody
    • Protein Caterpiller 16.1 antibody
    • Protein NLRC5 antibody
    see all

Images

  • Anti-NLRC5 antibody - N-terminal (ab178767) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size: 149 kDa

References

ab178767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up