Overview

  • Product name

  • Description

    Rabbit polyclonal to NLRX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human NLRX1 aa 150-195 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    FNPDACGRRVQTVVLYGTVGTGKSTLVRKMVLDWCYGRLPAFELLI


    Database link: Q86UT6

  • Positive control

    • Human breast carcinoma and mouse embryonic muscle tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA

    Aqueous buffered solution
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab218252 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Participates in antiviral signaling. Acts as a negative regulator of MAVS-mediated antiviral responses, through the inhibition of the virus-induced RLH (RIG-like helicase)-MAVS interaction (PubMed:18200010). Has no inhibitory function on NF-Kappa-B and type 1 interferon signaling pathways, but enhances NF-Kappa-B and JUN N-terminal kinase dependent signaling through the production of reactive oxygen species (PubMed:18219313).
  • Tissue specificity

    Ubiquitously expressed. Strongest expression in mammary gland, heart and muscle. Detected in HELA, 293T, THP-1, HL60, RAJI, and JURKAT cell lines (at protein level).
  • Sequence similarities

    Belongs to the NLRP family.
    Contains 7 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Caterpiller protein 11.3 antibody
    • CLR11.3 antibody
    • DLNB26 antibody
    • FLJ21478 antibody
    • MGC131937 antibody
    • MGC21025 antibody
    • NLR family member X1 antibody
    • NLR family, X1 antibody
    • Nlrx1 antibody
    • NLRX1_HUMAN antibody
    • NOD-like receptor X1 antibody
    • NOD26 antibody
    • NOD5 antibody
    • NOD9 antibody
    • Nucleotide-binding oligomerization domain protein 26 antibody
    • Nucleotide-binding oligomerization domain protein 5 antibody
    • Nucleotide-binding oligomerization domain protein 9 antibody
    • nucleotide-binding oligomerization domain, leucine rich repeat containing X1 antibody
    • Protein Caterpiller 11.3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded mouse embryonic muscle tissue labeling NLRX1 with ab218252 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human breast carcinoma tissue labeling NLRX1 with ab218252 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218252 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up