Overview

  • Product name

    Anti-NMDAR1 antibody [M308/48] - N-terminal (HRP)
    See all NMDAR1 primary antibodies
  • Description

    Mouse monoclonal [M308/48] to NMDAR1 - N-terminal (HRP)
  • Host species

    Mouse
  • Conjugation

    HRP
  • Tested applications

    Suitable for: IHC-Fr, IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Rat NMDAR1 aa 42-361 (N terminal). N terminal extracellular domain.
    Sequence:

    FREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAIL VSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTV PPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRLETLLEERESKA EKVLQFDPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNMT GSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQA VHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFN EDGDRKFANYSIMNLQNRKL


    Database link: NP_058706.1

  • Positive control

    • Rat brain tissue lysate
  • General notes

    The clone number has been updated from S308-48 to M308/48, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab183433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use a concentration of 0.1 - 1 µg/ml.
IHC-P Use a concentration of 0.1 - 1 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 105 kDa.

1 µg/ml of ab183433 is sufficient for detection of NMDAR1 in 20µg of rat brain membrane lysate.

ICC/IF Use at an assay dependent concentration.

Target

  • Function

    NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine. This protein plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. It mediates neuronal functions in glutamate neurotransmission. Is involved in the cell surface targeting of NMDA receptors.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR1/GRIN1 subfamily.
  • Post-translational
    modifications

    NMDA is probably regulated by C-terminal phosphorylation of an isoform of NR1 by PKC. Dephosphorylated on Ser-897 probably by protein phosphatase 2A (PPP2CB). Its phosphorylated state is influenced by the formation of the NMDAR-PPP2CB complex and the NMDAR channel activity.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Enriched in post-synaptic plasma membrane and post-synaptic densities.
  • Information by UniProt
  • Database links

  • Alternative names

    • GluN1 antibody
    • Glutamate [NMDA] receptor subunit zeta-1 antibody
    • Glutamate receptor ionotropic N methyl D aspartate 1 antibody
    • Glutamate receptor ionotropic, N-methyl-D aspartate, subunit 1 antibody
    • glutamate receptor ionotropic, NMDA 1 antibody
    • Grin1 antibody
    • MRD8 antibody
    • N methyl D aspartate receptor antibody
    • N methyl D aspartate receptor channel subunit zeta 1 antibody
    • N methyl D aspartate receptor subunit NR1 antibody
    • N-methyl-D-aspartate receptor subunit NR1 antibody
    • NMD-R1 antibody
    • NMDA 1 antibody
    • NMDA R1 antibody
    • NMDA receptor 1 antibody
    • NMDA1 antibody
    • NMDAR antibody
    • NMDZ1_HUMAN antibody
    • NR1 antibody
    see all

Images

  • Anti-NMDAR1 antibody [M308/48] - N-terminal (HRP) (ab183433) at 1/1000 dilution + rat brain membrane tissue lysate

    Predicted band size: 105 kDa

References

ab183433 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up