Overview

  • Product name

    Anti-NMDAR2A antibody [S327-95] - N-terminal
    See all NMDAR2A primary antibodies
  • Description

    Mouse monoclonal [S327-95] to NMDAR2A - N-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chimpanzee
  • Immunogen

    Fusion protein corresponding to Rat NMDAR2A aa 75-325. (extracellular N-terminus) NP_036705.3.
    Sequence:

    NRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQTFIPI LGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVT TIFPGYRDFISFIKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHS SVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPS GLISVSYDDWDYSLEARVRDGLGILTTAASSMLEKFSYIPEAKASCYGQA E


    Database link: Q00959

  • Positive control

    • WB: Monkey COS cells transfected with GFP-tagged NMDAR2A. ICC/IF: SK-N-BE cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.09% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    S327-95
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab240884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100.
WB 1/1000.

Target

  • Function

    NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2A/GRIN2A subfamily.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EPND antibody
    • FESD antibody
    • GluN2A antibody
    • Glutamate [NMDA] receptor subunit epsilon-1 antibody
    • Glutamate receptor antibody
    • Glutamate receptor ionotropic N methyl D aspartate 2A antibody
    • GRIN 2A antibody
    • GRIN2A antibody
    • hNR2A antibody
    • LKS antibody
    • N methyl D aspartate receptor channel, subunit epsilon 1 antibody
    • N Methyl D Aspartate Receptor Subtype 2A antibody
    • N methyl D aspartate receptor subunit 2A antibody
    • N-methyl D-aspartate receptor subtype 2A antibody
    • NMDA receptor subtype 2A antibody
    • NMDAR 2A antibody
    • NMDAR2A antibody
    • NMDE1_HUMAN antibody
    • NR2A antibody
    • OTTHUMP00000160135 antibody
    • OTTHUMP00000174531 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of SK-N-BE (human neuroblastoma cell line) cells labeling NMDAR2A using ab240884 at 1/100 for 60 minutes at RT. Cells were fixed in 4% formaldehyde for 15 minutes at RT.

    Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1/100 for 60 minutes at RT.

    Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1/1000, 1/5000 for 60 min RT, 5 min RT.

    (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) ab240884 (D) Composite.

  • Anti-NMDAR2A antibody [S327-95] - N-terminal (ab240884) at 1/200 dilution (16 hours at 4°C) + Monkey COS cells transfected with GFP-tagged NMDAR2A at 15 µg

    Secondary
    Goat Anti-Mouse IgG: HRP for 1 hour RT at 1/1000 dilution

    Developed using the ECL technique.

    Exposure time: 6 minutes


    Block: 2% BSA and 2% skimmed milk in 1X TBST.

References

ab240884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Rat Cell (rat neurons)
Permeabilization
Yes - 0.1% Triton
Specification
rat neurons
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 24°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Sep 25 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up