Anti-NMDAR2B antibody [N59/36] (ab93610)
Key features and details
- Mouse monoclonal [N59/36] to NMDAR2B
- Suitable for: Flow Cyt, WB
- Reacts with: Rat, Human
- Isotype: IgG2b
Overview
-
Product name
Anti-NMDAR2B antibody [N59/36]
See all NMDAR2B primary antibodies -
Description
Mouse monoclonal [N59/36] to NMDAR2B -
Host species
Mouse -
Specificity
No cross-reactivity with NMDAR2A. -
Tested applications
Suitable for: Flow Cyt, WBmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Dog -
Immunogen
Fusion protein corresponding to Rat NMDAR2B aa 20-271 (N terminal).
Sequence:AVSGSKARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVE LVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQT LTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIF SIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQ LKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTV PS
Database link: Q00960 -
Positive control
- Flow Cyt: SH-SY5Y cells.
-
General notes
The clone number has been updated from S59-36 to N59/36, both clone numbers name the same antibody clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, PBS -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N59/36 -
Isotype
IgG2b -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab93610 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt |
Use 1µg for 106 cells.
ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.
|
|
WB |
Use a concentration of 1 - 10 µg/ml. Detects a band of approximately 166 kDa (predicted molecular weight: 166 kDa).
|
Notes |
---|
Flow Cyt
Use 1µg for 106 cells. ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.
|
WB
Use a concentration of 1 - 10 µg/ml. Detects a band of approximately 166 kDa (predicted molecular weight: 166 kDa). |
Target
-
Function
NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine. -
Tissue specificity
Primarily found in the fronto-parieto-temporal cortex and hippocampus pyramidal cells, lower expression in the basal ganglia. -
Sequence similarities
Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2B/GRIN2B subfamily. -
Cellular localization
Cell membrane. Cell junction > synapse > postsynaptic cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 494009 Dog
- Entrez Gene: 2904 Human
- Entrez Gene: 24410 Rat
- Omim: 138252 Human
- SwissProt: Q5R1P3 Dog
- SwissProt: Q13224 Human
- SwissProt: Q00960 Rat
- Unigene: 654430 Human
see all -
Alternative names
- AW490526 antibody
- EIEE27 antibody
- Glutamate [NMDA] receptor subunit epsilon 2 antibody
see all
Images
-
All lanes : Anti-NMDAR2B antibody [N59/36] (ab93610) at 1/250 dilution
Lane 1 : Induced HEK-T lysates
Lane 2 : Non-Induced HEK-T lysates
Lane 3 : P23X HEK-T negative control lysates
Predicted band size: 166 kDa -
Overlay histogram showing SH-SY5Y cells stained with ab93610 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab93610, 2µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive result in 80% methanol (5 min) fixed SH-SY5Y cells used under the same conditions.
Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback -
Anti-NMDAR2B antibody [N59/36] (ab93610) at 1/1000 dilution + Rat brain membrane lysate at 15 µg with 1.5% BSA for 30 minutes at RT
Secondary
Sheep Anti-Mouse IgG: HRP for 1 hour at RT
Predicted band size: 166 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (15)
ab93610 has been referenced in 15 publications.
- Olivero G et al. Prolonged activation of CXCR4 hampers the release-regulating activity of presynaptic NMDA receptors in rat hippocampal synaptosomes. Neurochem Int 126:59-63 (2019). PubMed: 30858017
- Ji Y et al. CRMP2-derived peptide ST2-104 (R9-CBD3) protects SH-SY5Y neuroblastoma cells against Aß25-35-induced neurotoxicity by inhibiting the pCRMP2/NMDAR2B signaling pathway. Chem Biol Interact 305:28-39 (2019). PubMed: 30871964
- Seymen CM et al. Melatonin Modulates NMDA-Receptor 2B/Calpain-1/Caspase-12 Pathways in Rat Brain After Long Time Exposure to GSM Radiation. Turk Neurosurg N/A:N/A (2019). WB, IHC-P ; Rat . PubMed: 31608966
- Li Q et al. Impaired Cognitive Function and Altered Hippocampal Synaptic Plasticity in Mice Lacking Dermatan Sulfotransferase Chst14/D4st1. Front Mol Neurosci 12:26 (2019). PubMed: 30853887
- Li Y et al. Persistent Toxoplasma Infection of the Brain Induced Neurodegeneration Associated with Activation of Complement and Microglia. Infect Immun 87:N/A (2019). PubMed: 31182619