For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    nmdar2b-antibody-n5936-ab93610.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmission Receptors / Channels Ligand-Gated Ion Channels NMDA Receptors
Share by email

Anti-NMDAR2B antibody [N59/36] (ab93610)

  • Datasheet
  • SDS
Reviews (2) Submit a question References (15)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-NMDAR2B antibody [N59/36] (ab93610)
  • Flow Cytometry - Anti-NMDAR2B antibody [N59/36] (ab93610)
  • Western blot - Anti-NMDAR2B antibody [N59/36] (ab93610)

Key features and details

  • Mouse monoclonal [N59/36] to NMDAR2B
  • Suitable for: Flow Cyt, WB
  • Reacts with: Rat, Human
  • Isotype: IgG2b

You may also be interested in

Protein
Product image
Recombinant Human NMDAR2B protein (ab112298)
Biochemical
Product image
L-Glutamate, excitatory neurotransmitter (ab120049)
Primary
Product image
Anti-NMDAR1 antibody - Neuronal Marker (ab17345)

View more associated products

Overview

  • Product name

    Anti-NMDAR2B antibody [N59/36]
    See all NMDAR2B primary antibodies
  • Description

    Mouse monoclonal [N59/36] to NMDAR2B
  • Host species

    Mouse
  • Specificity

    No cross-reactivity with NMDAR2A.
  • Tested applications

    Suitable for: Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Dog
  • Immunogen

    Fusion protein corresponding to Rat NMDAR2B aa 20-271 (N terminal).
    Sequence:

    AVSGSKARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVE LVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQT LTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIF SIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQ LKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTV PS


    Database link: Q00960
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Flow Cyt: SH-SY5Y cells.
  • General notes

    The clone number has been updated from S59-36 to N59/36, both clone numbers name the same antibody clone.

     

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    N59/36
  • Isotype

    IgG2b
  • Research areas

    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • Ligand-Gated Ion Channels
    • NMDA Receptors
    • Neuroscience
    • Sensory System
    • Somatosensory system
    • Nociception
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Other

Associated products

  • Alternative Versions

    • PE Anti-NMDAR2B antibody [N59/36] (ab274365)
  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Goat Anti-Mouse IgG H&L (DyLight® 488) preadsorbed (ab96879)
  • Isotype control

    • Mouse IgG2b, kappa monoclonal [7E10G10] - Isotype Control (ab170192)
  • Recombinant Protein

    • Recombinant Human NMDAR2B protein (ab112298)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab93610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt
Use 1µg for 106 cells.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

WB
Use a concentration of 1 - 10 µg/ml. Detects a band of approximately 166 kDa (predicted molecular weight: 166 kDa).
Notes
Flow Cyt
Use 1µg for 106 cells.

ab170192 - Mouse monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

WB
Use a concentration of 1 - 10 µg/ml. Detects a band of approximately 166 kDa (predicted molecular weight: 166 kDa).

Target

  • Function

    NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine.
  • Tissue specificity

    Primarily found in the fronto-parieto-temporal cortex and hippocampus pyramidal cells, lower expression in the basal ganglia.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR2B/GRIN2B subfamily.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Target information above from: UniProt accession Q13224 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 494009 Dog
    • Entrez Gene: 2904 Human
    • Entrez Gene: 24410 Rat
    • Omim: 138252 Human
    • SwissProt: Q5R1P3 Dog
    • SwissProt: Q13224 Human
    • SwissProt: Q00960 Rat
    • Unigene: 654430 Human
    • Unigene: 9711 Rat
    see all
  • Alternative names

    • AW490526 antibody
    • EIEE27 antibody
    • Glutamate [NMDA] receptor subunit epsilon 2 antibody
    • Glutamate [NMDA] receptor subunit epsilon-2 antibody
    • Glutamate Receptor Ionotropic N Methyl D Aspartate 2B antibody
    • Glutamate Receptor Ionotropic N Methyl D Aspartate subunit 2B antibody
    • Glutamate receptor ionotropic NMDA2B antibody
    • Glutamate receptor subunit epsilon 2 antibody
    • Glutamate receptor, ionotropic, NMDA2B (epsilon 2) antibody
    • GRIN 2B antibody
    • GRIN2B antibody
    • hNR 3 antibody
    • hNR3 antibody
    • MGC142178 antibody
    • MGC142180 antibody
    • MRD6 antibody
    • N methyl D asparate receptor channel subunit epsilon 2 antibody
    • N methyl D aspartate receptor subtype 2B antibody
    • N methyl D aspartate receptor subunit 2B antibody
    • N methyl D aspartate receptor subunit 3 antibody
    • N-methyl D-aspartate receptor subtype 2B antibody
    • N-methyl-D-aspartate receptor subunit 3 antibody
    • NMDA NR2B antibody
    • NMDA R2B antibody
    • NMDAR2B antibody
    • NMDE2 antibody
    • NMDE2_HUMAN antibody
    • NME2 antibody
    • NR2B antibody
    • NR3 antibody
    see all

Images

  • Western blot - Anti-NMDAR2B antibody [N59/36] (ab93610)
    Western blot - Anti-NMDAR2B antibody [N59/36] (ab93610)
    All lanes : Anti-NMDAR2B antibody [N59/36] (ab93610) at 1/250 dilution

    Lane 1 : Induced HEK-T lysates
    Lane 2 : Non-Induced HEK-T lysates
    Lane 3 : P23X HEK-T negative control lysates

    Predicted band size: 166 kDa

  • Flow Cytometry - Anti-NMDAR2B antibody [N59/36] (ab93610)
    Flow Cytometry - Anti-NMDAR2B antibody [N59/36] (ab93610)
    Overlay histogram showing SH-SY5Y cells stained with ab93610 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab93610, 2µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2b [PLPV219] (ab91366, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive result in 80% methanol (5 min) fixed SH-SY5Y cells used under the same conditions.

    Please note that Abcam do not have any data for use of this antibody on non-fixed cells. We welcome any customer feedback
  • Western blot - Anti-NMDAR2B antibody [N59/36] (ab93610)
    Western blot - Anti-NMDAR2B antibody [N59/36] (ab93610)
    Anti-NMDAR2B antibody [N59/36] (ab93610) at 1/1000 dilution + Rat brain membrane lysate at 15 µg with 1.5% BSA for 30 minutes at RT

    Secondary
    Sheep Anti-Mouse IgG: HRP for 1 hour at RT

    Predicted band size: 166 kDa

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (15)

Publishing research using ab93610? Please let us know so that we can cite the reference in this datasheet.

ab93610 has been referenced in 15 publications.

  • Olivero G  et al. Prolonged activation of CXCR4 hampers the release-regulating activity of presynaptic NMDA receptors in rat hippocampal synaptosomes. Neurochem Int 126:59-63 (2019). PubMed: 30858017
  • Ji Y  et al. CRMP2-derived peptide ST2-104 (R9-CBD3) protects SH-SY5Y neuroblastoma cells against Aß25-35-induced neurotoxicity by inhibiting the pCRMP2/NMDAR2B signaling pathway. Chem Biol Interact 305:28-39 (2019). PubMed: 30871964
  • Seymen CM  et al. Melatonin Modulates NMDA-Receptor 2B/Calpain-1/Caspase-12 Pathways in Rat Brain After Long Time Exposure to GSM Radiation. Turk Neurosurg N/A:N/A (2019). WB, IHC-P ; Rat . PubMed: 31608966
  • Li Q  et al. Impaired Cognitive Function and Altered Hippocampal Synaptic Plasticity in Mice Lacking Dermatan Sulfotransferase Chst14/D4st1. Front Mol Neurosci 12:26 (2019). PubMed: 30853887
  • Li Y  et al. Persistent Toxoplasma Infection of the Brain Induced Neurodegeneration Associated with Activation of Complement and Microglia. Infect Immun 87:N/A (2019). PubMed: 31182619
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-2 of 2 Abreviews or Q&A

Immunocytochemistry/ Immunofluorescence abreview for Anti-NMDAR2B antibody [N59/36]

Excellent
Abreviews
Abreviews
abreview image
Application
Immunocytochemistry/ Immunofluorescence
Sample
Rat Cell (rat neurons)
Permeabilization
Yes - 0,5% Triton
Specification
rat neurons
Blocking step
Duolink blocking solution as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 37°C
Fixative
Paraformaldehyde
Read More

Abcam user community

Verified customer

Submitted Mar 18 2020

Immunocytochemistry abreview for Anti-NMDAR2B antibody [N59/36]

Excellent
Abreviews
Abreviews
abreview image
Application
Immunocytochemistry
Sample
Rat Cell (rat neurons)
Permeabilization
Yes - 0.1% Triton
Specification
rat neurons
Blocking step
(agent) for 30 minute(s) · Concentration: 2% · Temperature: 24°C
Fixative
Paraformaldehyde
Read More

Abcam user community

Verified customer

Submitted Mar 11 2020

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.