Overview

  • Product name

  • Description

    Rabbit polyclonal to NME5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NME5 aa 3-194. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    ISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPE QCSNFYVEKYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNS LVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIRFMFPEVIVEPIP IGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLK


    Database link: P56597

  • Positive control

    • IHC-P: Human prostate and kidney tissues. WB: Mouse and rat testis lysates; Recombinant human NME5 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231631 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 24 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Does not seem to have NDK kinase activity. Confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes including Gpx5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species.
  • Tissue specificity

    Specifically expressed in testis germinal cells.
  • Sequence similarities

    Belongs to the NDK family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Inhibitor of p53 induced apoptosis beta antibody
    • Inhibitor of p53-induced apoptosis-beta antibody
    • IPIA beta antibody
    • IPIA-beta antibody
    • NDK-H 5 antibody
    • NDK5_HUMAN antibody
    • NDP kinase homolog 5 antibody
    • NM23 H5 antibody
    • nm23-H5 antibody
    • Nm23-M5 antibody
    • NM23H5 antibody
    • NME/NM23 family member 5 antibody
    • NME5 antibody
    • Non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) antibody
    • Nonmetastatic cells 5, protein expressed in antibody
    • Nonmetastatic protein 23, homolog 5 antibody
    • Nucleoside diphosphate kinase homolog 5 antibody
    • Radial spoke 23 homolog antibody
    • RSPH23 antibody
    • Testis specific nm23 homolog antibody
    • Testis-specific nm23 homolog antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for NME5 using ab231631 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for NME5 using ab231631 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NME5 antibody (ab231631) at 2 µg/ml + Recombinant human NME5 protein

    Predicted band size: 24 kDa

  • Anti-NME5 antibody (ab231631) at 1 µg/ml + Mouse testis lysate

    Predicted band size: 24 kDa

  • Anti-NME5 antibody (ab231631) at 1 µg/ml + Rat testis lysate

    Predicted band size: 24 kDa

References

ab231631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up