Overview

  • Product name

  • Description

    Rabbit polyclonal to NME6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat NME6 aa 1-173. Expressed in E.coli. N-terminal tags.
    Sequence:

    MTSILRSPQTLQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELL WKPEDCRRFYREHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMG PTRVFRARHIAPDSIRGSLGLTDTRNTTHGSDSVVSASREIAAFFPDFSE QRWYEEEEPQLRCGPVHYSPEEG


    Database link: R9PXW5

  • Positive control

    • WB: Recombinant rat NME6 protein; Rat spleen tissue lysate. IHC-P: Rat cerebrum, liver, kidney, stomach, testis and lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 20 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Inhibitor of p53-induced apoptosis.
  • Tissue specificity

    Expressed at a moderately low level in many tissues. Most abundant in kidney, prostate, ovary, intestine, and spleen.
  • Sequence similarities

    Belongs to the NDK family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Inhibitor of p53 induced apoptosis alpha antibody
    • Inhibitor of p53-induced apoptosis-alpha antibody
    • IPIA ALPHA antibody
    • IPIA-alpha antibody
    • NDK 6 antibody
    • NDK6_HUMAN antibody
    • NDP kinase 6 antibody
    • NM23 H6 antibody
    • nm23-H6 antibody
    • NM23H6 antibody
    • Nme6 antibody
    • Nucleoside diphosphate kinase 6 antibody
    • OTTHUMP00000164810 antibody
    • OTTHUMP00000210736 antibody
    • OTTHUMP00000210737 antibody
    • OTTHUMP00000210738 antibody
    • OTTHUMP00000210741 antibody
    • OTTHUMP00000210742 antibody
    • OTTHUMP00000210744 antibody
    • OTTHUMP00000210745 antibody
    see all

Images

  • Anti-NME6 antibody (ab233442) at 3 µg/ml + Rat spleen tissue lysate

    Secondary
    HRP-linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 20 kDa

  • Formalin-fixed, paraffin-embedded rat cerebrum tissue stained for NME6 using ab233442 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for NME6 using ab233442 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for NME6 using ab233442 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for NME6 using ab233442 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for NME6 using ab233442 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat lung tissue stained for NME6 using ab233442 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG at 2 µg/ml. DAB staining.

  • Anti-NME6 antibody (ab233442) at 3 µg/ml + Recombinant rat NME6 protein

    Predicted band size: 20 kDa

References

ab233442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up