Overview

  • Product name

    Anti-Nmnat1/NMNAT antibody
    See all Nmnat1/NMNAT primary antibodies
  • Description

    Rabbit polyclonal to Nmnat1/NMNAT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Nmnat1/NMNAT aa 1-279.
    Sequence:

    MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISP VGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLR HHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKSLEPKTKAVPK VKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYES DVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEK HNLYSSESEDRNAGVILAPLQRNTAEAKT


    Database link: Q9HAN9

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: PC-3 cells.
  • General notes

     This product was previously labelled as Nmnat1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab229772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP (PubMed:17402747). Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency (PubMed:17402747). Can use triazofurin monophosphate (TrMP) as substrate (PubMed:17402747). Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+) (PubMed:17402747). For the pyrophosphorolytic activity, prefers NAD(+) and NaAD as substrates and degrades NADH, nicotinic acid adenine dinucleotide phosphate (NHD) and nicotinamide guanine dinucleotide (NGD) less effectively (PubMed:17402747). Involved in the synthesis of ATP in the nucleus, together with PARP1, PARG and NUDT5 (PubMed:27257257). Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming (PubMed:27257257). Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NaADP(+) (PubMed:17402747). Protects against axonal degeneration following mechanical or toxic insults.
  • Tissue specificity

    Widely expressed with highest levels in skeletal muscle, heart and kidney. Also expressed in the liver pancreas and placenta. Widely expressed throughout the brain.
  • Pathway

    Cofactor biosynthesis; NAD(+) biosynthesis; NAD(+) from nicotinamide D-ribonucleotide: step 1/1.
    Cofactor biosynthesis; NAD(+) biosynthesis; deamido-NAD(+) from nicotinate D-ribonucleotide: step 1/1.
  • Involvement in disease

    Leber congenital amaurosis 9
  • Sequence similarities

    Belongs to the eukaryotic NMN adenylyltransferase family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.7.7.1 antibody
    • LCA9 antibody
    • Leber's congenital amaurosis 9 antibody
    • NaMN adenylyltransferase 1 antibody
    • nicotinamide nucleotide adenylyltransferase 1 antibody
    • Nicotinamide-nucleotide adenylyltransferase 1 antibody
    • Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 antibody
    • nicotinate nucleotide adenylyltransferase 1 antibody
    • Nicotinate-nucleotide adenylyltransferase 1 antibody
    • NMN adenylyltransferase 1 antibody
    • NMN/NaMN adenylyltransferase 1 antibody
    • NMNA1_HUMAN antibody
    • Nmnat 1 antibody
    • Nmnat1 antibody
    • OTTHUMP00000001731 antibody
    • OTTHUMP00000001732 antibody
    • OTTHUMP00000035892 antibody
    • PNAT 1 antibody
    • PNAT1 antibody
    • pyridine nucleotide adenylyltransferase 1 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for Nmnat1/NMNAT using ab229772 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for Nmnat1/NMNAT (green) using ab229772 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab229772 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up