Overview

  • Product name

  • Description

    Rabbit polyclonal to NMT1/NMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Chimpanzee, Rhesus monkey, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human NMT1/NMT aa 68-118. The exact sequence is proprietary. (NP_066565.1).
    Sequence:

    GSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSY Q


    Database link: P30419

  • Positive control

    • HeLa, 293T, Jurkat, TCMK-1 and NIH 3T3 whole cell lysates.
  • General notes

     This product was previously labelled as NMT1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab186131 was affinity purified using an epitope specific to NMT1/NMT immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 57 kDa.

Target

Images

  • All lanes : Anti-NMT1/NMT antibody (ab186131) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 57 kDa


    Exposure time: 30 seconds
  • Detection of NMT1/NMT in immunoprecipitates of 293T whole cell lysate (1 mg for IP, 20% of IP loaded) using ab186131 at 6 µg per reaction for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 3 seconds.

References

ab186131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up