Overview

  • Product name

  • Description

    Rabbit polyclonal to NMT1/NMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NMT1/NMT aa 67-135.
    Sequence:

    KGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRS YQFWDTQPVPKLGEVVNTH


    Database link: P30419

  • Positive control

    • IHC-P: Human placenta tissue. WB: RT4, NBT-II and NIH/3T3 cell lysate.
  • General notes

     This product was previously labelled as NMT1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223729 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 57 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.
  • Tissue specificity

    Heart, gut, kidney, liver and placenta.
  • Sequence similarities

    Belongs to the NMT family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alternative, short form NMT S antibody
    • EC 2.3.1.97 antibody
    • Glycylpeptide N tetradecanoyltransferase 1 antibody
    • Glycylpeptide N-tetradecanoyltransferase 1 antibody
    • Long form, NMT L antibody
    • Myristoyl CoA:protein N myristoyltransferase 1 antibody
    • Myristoyl-CoA:protein N-myristoyltransferase 1 antibody
    • N myristoyltransferase 1 antibody
    • NMT 1 antibody
    • NMT antibody
    • nmt1 antibody
    • NMT1_HUMAN antibody
    • Peptide N myristoyltransferase 1 antibody
    • Peptide N-myristoyltransferase 1 antibody
    • Type I N myristoyltransferase antibody
    • Type I N-myristoyltransferase antibody
    see all

Images

  • Paraffin embedded human placenta tissue stained for NMT1/NMT with ab223729 (1/200 dilution) in immunohistochemical analysis.

  • Anti-NMT1/NMT antibody (ab223729) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 57 kDa

  • All lanes : Anti-NMT1/NMT antibody (ab223729) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat Wistar bladder tumor cells) cell lysate

    Predicted band size: 57 kDa

References

ab223729 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223729.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up