Overview

  • Product name

  • Description

    Rabbit polyclonal to NMT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human NMT2 aa 62-210.
    Sequence:

    GGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNI DEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWD TLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLL


    Database link: O60551

  • Positive control

    • IHC: Human testis tissue. WB: RT4 cell lysate. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 57 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.
  • Sequence similarities

    Belongs to the NMT family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.3.1.97 antibody
    • Glycylpeptide N tetradecanoyltransferase 2 antibody
    • Glycylpeptide N-tetradecanoyltransferase 2 antibody
    • Myristoyl CoA:protein N myristoyltransferase 2 antibody
    • Myristoyl-CoA:protein N-myristoyltransferase 2 antibody
    • N-myristoyltransferase 2 antibody
    • NMT 2 antibody
    • NMT2 antibody
    • NMT2_HUMAN antibody
    • Peptide N myristoyltransferase 2 antibody
    • Peptide N-myristoyltransferase 2 antibody
    • Type II N myristoyltransferase antibody
    • Type II N-myristoyltransferase antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for NMT2 using ab224045 at 1/500 dilution in immunohistochemical analysis.

  • Anti-NMT2 antibody (ab224045) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 57 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for NMT2 (green) using ab224045 at 4 µg/ml in ICC/IF.

References

ab224045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up