Overview

  • Product name

  • Description

    Rabbit polyclonal to NMT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human NMT2 aa 1-120.
    Sequence:

    MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKK KQKRKKEKPNSGGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMEL LSACQGPARNIDEAAKHRYQ


    Database link: O60551

  • Positive control

    • IHC-P: Human testis and prostate tissues. IP: HepG2 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab230016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.
  • Sequence similarities

    Belongs to the NMT family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.3.1.97 antibody
    • Glycylpeptide N tetradecanoyltransferase 2 antibody
    • Glycylpeptide N-tetradecanoyltransferase 2 antibody
    • Myristoyl CoA:protein N myristoyltransferase 2 antibody
    • Myristoyl-CoA:protein N-myristoyltransferase 2 antibody
    • N-myristoyltransferase 2 antibody
    • NMT 2 antibody
    • NMT2 antibody
    • NMT2_HUMAN antibody
    • Peptide N myristoyltransferase 2 antibody
    • Peptide N-myristoyltransferase 2 antibody
    • Type II N myristoyltransferase antibody
    • Type II N-myristoyltransferase antibody
    see all

Images

  • NMT2 was immunoprecipitated from 500 µg of  HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with 4 µg of ab230016.

    Lane 1: 1 µg Rabbit monoclonal IgG instead of ab230016 in HepG2 whole cell lysate.

    Lane 2: ab230016 IP in HepG2 whole cell lysate.

    Lane 3: HepG2 whole cell lysate 20 µg (input).

    For western blotting, an HRP-conjugated anti-rabbit IgG, specific to the non-reduced form of IgG was used as the Secondary antibody at 1/50000 dilution.

  • Paraffin-embedded human prostate tissue stained for NMT2 using ab230016 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for NMT2 using ab230016 at 1/100 dilution in immunohistochemical analysis.

References

ab230016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230016.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up