Overview

  • Product name

  • Description

    Rabbit polyclonal to NOA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human NOA1 aa 42-174.
    Sequence:

    FQHSSSLGRELPYDPVDTEGFGEGGDMQERFLFPEYILDPEPQPTREKQL QELQQQQEEEERQRQQRREERRQQNLRARSREHPVVGHPDPALPPSGVNC SGCGAELHCQDAGVPGYLPREKFLRTAEADGGL


    Database link: Q8NC60

  • Positive control

    • WB: Jurkat and HeLa whole cell lysate. Mouse kidney tissue lysate. IHC-P: Human tonsil tissue.
  • General notes

     This product was previously labelled as C4orf14

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224747 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    The exact function of C4orf14 is currently unknown
  • Database links

  • Alternative names

    • Chromosome 4 open reading frame 14 antibody
    • hAtNOS1 antibody
    • hNOA1 antibody
    • Hypothetical protein LOC84273 antibody
    • mAtNOS1 antibody
    • MGC3232 antibody
    • MTG3 antibody
    • Nitric oxide associated 1 antibody
    • NOA1 antibody
    • Putative ortholog of Arabidopsis mitochondrial nitric oxide synthase antibody
    • Uncharacterized protein C4orf14 antibody
    see all

Images

  • All lanes : Anti-NOA1 antibody (ab224747) at 1/500 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.
  • Paraffin embedded human tonsil tissue stained for NOA1 with ab224747 (1/100 dilution) in immunohistochemical analysis.

References

ab224747 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224747.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up