Overview

  • Product name

  • Description

    Rabbit polyclonal to NOB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NOB1 aa 103-229.
    Sequence:

    LKQEPQKVKVSSSIQHPETPLHISGFHLPYKPKPPQETEKGHSACEPENL EFSSFMFWRNPLPNIDHELQELLIDRGEDVPSEEEEEEENGFEDRKDDSD DDGGGWITPSNIKQIQQELEQCDVPED


    Database link: Q9ULX3

  • Positive control

    • WB: HeLa whole cell lysate; Mouse brain, kidney and stomach tissue lysates. IHC-P: Human thyroid and placenta tissues. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 47 kDa (predicted molecular weight: 47 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    May play a role in mRNA degradation.
  • Tissue specificity

    Detected in liver, lung, placenta, endothelial cells and spleen.
  • Sequence similarities

    Belongs to the NOB1 family.
    Contains 1 PINc domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adenocarcinoma antigen recognized by T lymphocytes 4 antibody
    • ART 4 antibody
    • ART4 antibody
    • MST158 antibody
    • MSTP158 antibody
    • Nin one binding protein antibody
    • NIN1/PSMD8 binding protein 1 homolog antibody
    • NIN1/RPN12 binding protein 1 homolog (S. cerevisiae) antibody
    • nob1 antibody
    • NOB1_HUMAN antibody
    • NOB1P antibody
    • Phosphorylation regulatory protein HP-10 antibody
    • Protein ART-4 antibody
    • Protein ART4 antibody
    • PSMD8 binding protein 1 antibody
    • PSMD8BP1 antibody
    • RNA binding protein NOB1 antibody
    • RNA-binding protein NOB1 antibody
    see all

Images

  • All lanes : Anti-NOB1 antibody (ab224619) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Mouse brain tissue lysate
    Lane 3 : Mouse kidney tissue lysate
    Lane 4 : Mouse stomach tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 47 kDa
    Observed band size: 47 kDa

  • Paraffin-embedded human thyroid tissue stained for NOB1 using ab224619 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for NOB1 using ab224619 at 1/100 dilution in immunohistochemical analysis.

  • A549 (human lung carcinoma cell line) cells stained for NOB1 (green) using ab224619 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

This product has been referenced in:

  • Liu H  et al. MicroRNA-744 suppresses cell proliferation and invasion of papillary thyroid cancer by directly targeting NOB1. Mol Med Rep 19:1903-1910 (2019). Read more (PubMed: 30628685) »
  • Zhang J  et al. LncRNA OIP5-AS1 Promotes the Proliferation of Hemangioma Vascular Endothelial Cells via Regulating miR-195-5p/NOB1 Axis. Front Pharmacol 10:449 (2019). Read more (PubMed: 31068824) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up