Overview

  • Product name

  • Description

    Rabbit polyclonal to NOD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human NOD1 aa 64-105 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    QPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLL


    Database link: Q9Y239

  • Positive control

    • Mouse spleen, rat lung and Human placenta tissues.
  • General notes

     This product was previously labelled as CARD4

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol, 48% ddH20
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/1000.

Target

  • Function

    Enhances caspase-9-mediated apoptosis. Induces NF-kappa-B activity via RIPK2 and IKK-gamma. Confers responsiveness to intracellular bacterial lipopolysaccharides (LPS). Forms an intracellular sensing system along with ARHGEF2 for the detection of microbial effectors during cell invasion by pathogens. Required for RHOA and RIPK2 dependent NF-kappa-B signaling pathway activation upon S.flexneri cell invasion. Involved not only in sensing peptidoglycan (PGN)-derived muropeptides but also in the activation of NF-kappa-B by Shigella effector proteins IpgB2 and OspB. Recruits NLRP10 to the cell membrane following bacterial infection.
  • Tissue specificity

    Highly expressed in adult heart, skeletal muscle, pancreas, spleen and ovary. Also detected in placenta, lung, liver, kidney, thymus, testis, small intestine and colon.
  • Sequence similarities

    Contains 1 CARD domain.
    Contains 9 LRR (leucine-rich) repeats.
    Contains 1 NACHT domain.
  • Post-translational
    modifications

    Ubiquitinated. 'Lys-48'-linked polyubiquitination by RNF34 promotes proteasomal degradation and thereby negatively regulates NOD1 for instance in NF-kappa-B activition.
  • Cellular localization

    Cytoplasm. Cell membrane. Apical cell membrane. Basolateral cell membrane. Detected in the cytoplasm and at the cell membrane. Following bacterial infection, localizes to bacterial entry sites in the cell membrane. Recruited to the basolateral and apical membranes in polarized epithelial cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • CARD 4 antibody
    • CARD4 antibody
    • Caspase recruitment domain 4 antibody
    • Caspase recruitment domain containing protein 4 antibody
    • Caspase recruitment domain family member 4 antibody
    • Caspase recruitment domain protein 4 antibody
    • Caspase recruitment domain-containing protein 4 antibody
    • CLR 7.1 antibody
    • CLR7.1 antibody
    • NLR family CARD domain containing 1 antibody
    • NLRC 1 antibody
    • NLRC1 antibody
    • NOD 1 antibody
    • Nod1 antibody
    • NOD1 protein antibody
    • NOD1_HUMAN antibody
    • Nucleotide binding oligomerization domain containing 1 antibody
    • Nucleotide binding oligomerization domain leucine rich repeat and CARD domain containing 1 antibody
    • Nucleotide-binding oligomerization domain-containing protein 1 antibody
    • Protein Nod1 antibody
    see all

Images

  • All lanes : Anti-NOD1 antibody (ab217798) at 1/1000 dilution

    Lane 1 : Raw264.7 cell lysates
    Lane 2 : Mouse thymus lysates

    Secondary
    All lanes : Conjugated secondary antibody at 1/20000 dilution
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue labeling NOD1 with ab217798 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat lung tissue labeling NOD1 with ab217798 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse spleen tissue labeling NOD1 with ab217798 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up