Overview

  • Product name

    Anti-NOF antibody
  • Description

    Rabbit polyclonal to NOF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human NOF aa 1-166.
    Sequence:

    MAATMFRATLRGWRTGVQRGCGLRLLSQTQGPPDYPRFVESVDEYQFVER LLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDI THGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRIK GYFDQELKAWLLEKGF


    Database link: Q13405

  • Positive control

    • WB: COLO 320 whole cell lysate; Mouse liver and kidney lysates. IHC-P: Human kidney and rectum tissues.
  • General notes

    Previously labelled as MRPL49.

Properties

Applications

Our Abpromise guarantee covers the use of ab235401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 19 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Mitochondria have their own translation system for production of 13 inner membrane proteins essential for oxidative phosphorylation. NOF is a component of the large subunit of the mitochondrial ribosome that is encoded by the nuclear genome. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene and the gene for the HRD1 protein use in their respective 3' UTRs some of the same genomic sequence. Pseudogenes corresponding to this gene are found on chromosomes 5q and 8p.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • 39S ribosomal protein L49 mitochondrial antibody
    • C11orf4 antibody
    • Chromosome 11 open reading frame 4 antibody
    • L49mt antibody
    • MGC10656 antibody
    • Mitochondrial ribosomal protein L49 antibody
    • MRP L49 antibody
    • MRPL49 antibody
    • Neighbor of FAU antibody
    • Next to FAU antibody
    • NOF antibody
    • NOF1 antibody
    • Protein NOF1 antibody
    • RM49 antibody
    see all

Images

  • All lanes : Anti-NOF antibody (ab235401) at 1/1000 dilution

    Lane 1 : COLO 320 whole cell lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 19 kDa

  • Paraffin-embedded human kidney tissue stained for NOF using ab235401 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human rectum tissue stained for NOF using ab235401 at 1/100 dilution in immunohistochemical analysis.

References

ab235401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up