Overview

  • Product name

    Anti-Nogo Receptor antibody [4H43]
    See all Nogo Receptor primary antibodies
  • Description

    Mouse monoclonal [4H43] to Nogo Receptor
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Nogo Receptor aa 27-446 (extracellular). mature form
    Sequence:

    CPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAAS FRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATF HGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRD LGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLG RLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQ KFRGSSSEVPCSLPQRLAGRDLKRLAANDLQGCAVATGPYHPIWTGRATD EEPLGLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDSPPGNGSGP RHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCSRKNRTR SHCRLGQAGSGGGGTGDSEG


    Database link: Q9BZR6

Properties

Applications

Our Abpromise guarantee covers the use of ab196514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 51 kDa.

Target

References

ab196514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up