Overview

  • Product name

    Anti-Nogo Receptor antibody - C-terminal
    See all Nogo Receptor primary antibodies
  • Description

    Rabbit polyclonal to Nogo Receptor - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Nogo Receptor aa 244-473 (C terminal).
    Sequence:

    EALAPLRALQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQRL AGRDLKRLAANDLQGCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADK ASVLEPGRPASAGNALKGRVPPGDSPPGNGSGPRHINDSPFGTLPGSAEP PLTAVRPEGSEPPGFPTSGPRRRPGCSRKNRTRSHCRLGQAGSGGGGTGD SEGSGALPSLTCSLTPLGLALVLWTVLGPC


    Database link: Q9BZR6

  • Positive control

    • Skeletal Muscle (Mouse) Whole Cell Lysate (ab3869) can be used as a positive control in WB. HepG2, BT474, U937, mouse brain, heart, skeletal muscle and kidney extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 51 kDa.

Target

Images

  • All lanes : Anti-Nogo Receptor antibody - C-terminal (ab189792) at 1/500 dilution

    Lane 1 : HepG2 extract
    Lane 2 : BT474 extract
    Lane 3 : U937 extract
    Lane 4 : Mouse brain extract
    Lane 5 : Mouse heart extract
    Lane 6 : Mouse skeletal extract
    Lane 7 : Mouse kidney extract

    Predicted band size: 51 kDa

References

ab189792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up