Overview

  • Product name

    Anti-NOLA1 antibody
  • Description

    Rabbit polyclonal to NOLA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human NOLA1 aa 54-90.
    Sequence:

    GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT


    Database link: Q9NY12

  • Positive control

    • Human colon, liver and liver cancer tissue, Human U-2 cell line

Properties

Applications

Our Abpromise guarantee covers the use of ab188617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 22 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
  • Sequence similarities

    Belongs to the GAR1 family.
  • Domain

    Interaction with SMN1 requires at least one of the RGG-box regions.
  • Cellular localization

    Nucleus, nucleolus. Nucleus, Cajal body. Also localized to Cajal bodies (coiled bodies).
  • Information by UniProt
  • Database links

  • Alternative names

    • Gar1 antibody
    • GAR1_HUMAN antibody
    • H/ACA ribonucleoprotein complex subunit 1 antibody
    • nucleolar protein family A member 1 (H/ACA small nucleolar RNPs) antibody
    • Nucleolar protein family A member 1 antibody
    • snoRNP protein GAR1 antibody
    see all

Images

  • Anti-NOLA1 antibody (ab188617) + Human liver tissue

    Predicted band size: 22 kDa
    Observed band size: 22 kDa



    Recommended conditions: Dilution: 1:100 - 1:250
  • Immunofluorescent staining of Human cell line U-2 OS labeling NOLA1 using ab188617 at 4 ug/mL

  • Immunohistochemical analysis of Human liver cancer tissue labeling NOLA1 using ab188617 at a 1/500 dilution

  • Immunohistochemical analysis of Human liver tissue labeling NOLA1 using ab188617 at a 1/500 dilution

  • Immunohistochemical analysis of Human colon tissue labeling NOLA1 using ab188617 at a 1/500 dilution

References

ab188617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (3T3 cell line)
Gel Running Conditions
Non-reduced Non-Denaturing (Native) (12)
Loading amount
40 µg
Specification
3T3 cell line
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Aug 07 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up