Overview

  • Product name

  • Description

    Rabbit polyclonal to NOLC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human NOLC1 aa 575-664.
    Sequence:

    VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSP FRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF


    Database link: Q14978

  • Positive control

    • Human cerebral cortex tissue; HEK 293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Related to nucleologenesis, may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. May play an important role in transcription catalyzed by RNA polymerase I.
  • Sequence similarities

    Contains 1 LisH domain.
  • Post-translational
    modifications

    Undergoes rapid and massive phosphorylation/dephosphorylation cycles on CK2 and PKC sites. There is evidence suggesting that CDK1 kinase phosphorylates p130 at the M-phase.
  • Cellular localization

    Nucleus > nucleolus. Cytoplasm. Shuttles between the nucleolus and the cytoplasm. At telophase it begins to assemble into granular-like pre-nucleolar bodies which are subsequently relocated to nucleoli at the early G1-phase.
  • Information by UniProt
  • Database links

  • Alternative names

    • 140 kDa nucleolar phosphoprotein antibody
    • HCV NS5A trans regulated protein 13 antibody
    • HCV NS5A transactivated protein 13 antibody
    • HCV NS5A-transactivated protein 13 antibody
    • Hepatitis C virus NS5A transactivated protein 13 antibody
    • Hepatitis C virus NS5A-transactivated protein 13 antibody
    • KIAA0035 antibody
    • NOLC 1 antibody
    • NOLC1 antibody
    • NOLC1_HUMAN antibody
    • NOPP 130 antibody
    • NOPP 140 antibody
    • NOPP130 antibody
    • Nopp140 antibody
    • NS5ATP13 antibody
    • Nucleolar 130 kDa protein antibody
    • Nucleolar and coiled body phosphoprotein 1 antibody
    • Nucleolar and coiled body phosphprotein 1 antibody
    • Nucleolar and coiled-body phosphoprotein 1 antibody
    • Nucleolar phosphoprotein p130 antibody
    • Nucleolar protein p130 antibody
    • P130 antibody
    see all

Images

  • Immunofluorescent analysis of HEK 293 cells (PFA-fixed/Triton X-100 permeabilized) labeling NOLC1 with ab204318 at 4 µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue, labeling NOLC1 with ab204318 at 1/500 dilution.

References

ab204318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (HEK293T cells)
Gel Running Conditions
Reduced Denaturing (8% SDS-PAGE protein gel)
Loading amount
18 µg
Treatment
siRNA transfect reagent with 50nM/100nM NOLC1/Negative control siRNA for 72h
Specification
HEK293T cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Sep 17 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up