Overview

  • Product name

    Anti-non-muscle Myosin IIB/MYH10 antibody
    See all non-muscle Myosin IIB/MYH10 primary antibodies
  • Description

    Rabbit polyclonal to non-muscle Myosin IIB/MYH10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human non-muscle Myosin IIB/MYH10 aa 1905-1974.
    Sequence:

    RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLE LSDDDTESKTSDVNETQPPQ


    Database link: P35580

  • Positive control

    • Human cerebellum tissue; Human liver and tonsil lysates; HEK293 cells.
  • General notes

     This product was previously labelled as non-muscle Myosin IIB

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 229 kDa.

Target

  • Function

    Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.
  • Tissue specificity

    Isoform 1 is expressed in cerebellum and spinal chord. Isoform 2 is expressed in cerebrum and retina. Isoform 3 is expressed in the cerebrum and to a much lower extent in cerebellum.
  • Sequence similarities

    Contains 1 IQ domain.
    Contains 1 myosin head-like domain.
  • Domain

    The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.
  • Post-translational
    modifications

    Phosphorylated by ABL2.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cellular myosin heavy chain antibody
    • Cellular myosin heavy chain type B antibody
    • Cellular myosin heavy chain type B type B antibody
    • MGC134913 antibody
    • MGC134914 antibody
    • MYH 10 antibody
    • Myh10 antibody
    • MYH10_HUMAN antibody
    • Myosin 10 antibody
    • Myosin heavy chain 10 antibody
    • Myosin heavy chain 10 non muscle antibody
    • Myosin heavy chain antibody
    • Myosin heavy chain non muscle 11b antibody
    • Myosin heavy chain nonmuscle IIb antibody
    • Myosin heavy chain nonmuscle type B antibody
    • Myosin heavy polypeptide 10 non muscle antibody
    • Myosin-10 antibody
    • Myosin10 antibody
    • NMMHC B antibody
    • NMMHC II b antibody
    • NMMHC II-b antibody
    • NMMHC IIB antibody
    • NMMHC-B antibody
    • NMMHC-IIB antibody
    • NMMHCB antibody
    • Non muscle myosin heavy chain B antibody
    • Non muscle myosin heavy chain IIB antibody
    • Non muscle myosin II heavy chain B antibody
    • non-muscle IIb antibody
    • Non-muscle myosin heavy chain B antibody
    • Non-muscle myosin heavy chain IIb antibody
    • Nonmuscle myosin heavy chain B antibody
    • Nonmuscle myosin heavy chain IIB antibody
    • Nonmuscle myosin II heavy chain B antibody
    • Nonmuscle myosin IIB antibody
    • type B antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebellum tissue labeling non-muscle Myosin IIB/MYH10 with ab204358 at 1/1000 dilution.

  • All lanes : Anti-non-muscle Myosin IIB/MYH10 antibody (ab204358) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 229 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HEK293 cells labeling non-muscle Myosin IIB/MYH10 with ab204358 at 4 µg/ml (green).

References

This product has been referenced in:

  • Chen P  et al. The expression and functional activities of smooth muscle myosin and non-muscle myosin isoforms in rat prostate. J Cell Mol Med 22:576-588 (2018). Read more (PubMed: 28990332) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up