Overview

  • Product name

    Anti-non-muscle Myosin IIB/MYH10 antibody
    See all non-muscle Myosin IIB/MYH10 primary antibodies
  • Description

    Rabbit polyclonal to non-muscle Myosin IIB/MYH10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human non-muscle Myosin IIB/MYH10 aa 438-716. Expressed in E.coli.
    Sequence:

    TYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCIN YTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPAN PPGVLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCI IHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDEIQNIQ RASFYDSVSGLHEPPVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQL YKESLTKLMATLRNTNPNFVRCIIPNHEK


    Database link: P35580-4

  • Positive control

    • WB: Recombinant human non-muscle Myosin IIB/MYH10 protein; Mouse cerebrum lysate; Pig cerebrum lysate. IHC-P: Human breast cancer, liver and kidney tissue.
  • General notes

     This product was previously labelled as non-muscle Myosin IIB

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 229 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.
  • Tissue specificity

    Isoform 1 is expressed in cerebellum and spinal chord. Isoform 2 is expressed in cerebrum and retina. Isoform 3 is expressed in the cerebrum and to a much lower extent in cerebellum.
  • Sequence similarities

    Contains 1 IQ domain.
    Contains 1 myosin head-like domain.
  • Domain

    The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.
  • Post-translational
    modifications

    Phosphorylated by ABL2.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cellular myosin heavy chain antibody
    • Cellular myosin heavy chain type B antibody
    • Cellular myosin heavy chain type B type B antibody
    • MGC134913 antibody
    • MGC134914 antibody
    • MYH 10 antibody
    • Myh10 antibody
    • MYH10_HUMAN antibody
    • Myosin 10 antibody
    • Myosin heavy chain 10 antibody
    • Myosin heavy chain 10 non muscle antibody
    • Myosin heavy chain antibody
    • Myosin heavy chain non muscle 11b antibody
    • Myosin heavy chain nonmuscle IIb antibody
    • Myosin heavy chain nonmuscle type B antibody
    • Myosin heavy polypeptide 10 non muscle antibody
    • Myosin-10 antibody
    • Myosin10 antibody
    • NMMHC B antibody
    • NMMHC II b antibody
    • NMMHC II-b antibody
    • NMMHC IIB antibody
    • NMMHC-B antibody
    • NMMHC-IIB antibody
    • NMMHCB antibody
    • Non muscle myosin heavy chain B antibody
    • Non muscle myosin heavy chain IIB antibody
    • Non muscle myosin II heavy chain B antibody
    • non-muscle IIb antibody
    • Non-muscle myosin heavy chain B antibody
    • Non-muscle myosin heavy chain IIb antibody
    • Nonmuscle myosin heavy chain B antibody
    • Nonmuscle myosin heavy chain IIB antibody
    • Nonmuscle myosin II heavy chain B antibody
    • Nonmuscle myosin IIB antibody
    • type B antibody
    see all

Images

  • Anti-non-muscle Myosin IIB/MYH10 antibody (ab232975) at 2 µg/ml + Recombinant human non-muscle Myosin IIB/MYH10 protein

    Predicted band size: 229 kDa

  • Anti-non-muscle Myosin IIB/MYH10 antibody (ab232975) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 229 kDa

  • Anti-non-muscle Myosin IIB/MYH10 antibody (ab232975) at 2 µg/ml + Pig cerebrum lysate

    Predicted band size: 229 kDa

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for non-muscle Myosin IIB/MYH10 using ab232975 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for non-muscle Myosin IIB/MYH10 using ab232975 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for non-muscle Myosin IIB/MYH10 using ab232975 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232975 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232975.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up