Overview

  • Product name

  • Description

    Rabbit polyclonal to NOP10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human NOP10 aa 1-64.
    Sequence:

    MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK RFKVLMTQQPRPVL


    Database link: Q9NPE3

  • Positive control

    • WB: HEK-293T, HeLa, Jurkat and Caco-2 whole cell lysates. IHC-P: Human breast cancer and kidney tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 8 kDa.

Target

  • Function

    Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.
  • Involvement in disease

    Defects in NOP10 are a cause of dyskeratosis congenita autosomal recessive (ARDKC) [MIM:224230]. ARDKC is a rare, progressive bone marrow failure syndrome characterized by the triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. Early mortality is often associated with bone marrow failure, infections, fatal pulmonary complications, or malignancy.
  • Sequence similarities

    Belongs to the NOP10 family.
  • Cellular localization

    Nucleus > nucleolus. Nucleus > Cajal body. Also localized to Cajal bodies.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKCB1 antibody
    • H/ACA ribonucleoprotein complex subunit 3 antibody
    • homolog of yeast Nop10p antibody
    • MGC70651 antibody
    • NOLA3 antibody
    • NOP10 antibody
    • NOP10 ribonucleoprotein homolog (yeast) antibody
    • NOP10_HUMAN antibody
    • NOP10P antibody
    • Nucleolar protein 10 antibody
    • Nucleolar protein family A member 3 antibody
    • nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs) antibody
    • snoRNP protein NOP10 antibody
    see all

Images

  • All lanes : Anti-NOP10 antibody (ab235339) at 1/1000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 4 : Caco-2 (Human colorectal adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 8 kDa

  • Paraffin-embedded human breast cancer tissue stained for NOP10 with ab235339 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for NOP10 with ab235339 at 1/100 dilution in immunohistochemical analysis.

References

ab235339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up