Overview

  • Product name

  • Description

    Rabbit polyclonal to NOP58
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human NOP58 aa 1-529.
    Sequence:

    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKF QDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKE KLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYR LKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISD NLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEED ICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQT SPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLED RGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDK EDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEP LSEEEPCTSTAIASPEKKKKKKKKRENED


    Database link: Q9Y2X3

  • Positive control

    • WB: Mouse brain lysate; K562, MCF7, HeLa and Jurkat, HEK-293T and HEK-293 whole cell lysates. IHC-P: Human tonsil and liver cancer tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236724 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 60 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • Anti-NOP58 antibody (ab236724) at 1/500 dilution + Mouse brain lysate

    Secondary
    Goat polyclonal to Rabbit IgG at 1/5000 dilution

    Predicted band size: 60 kDa

  • Paraffin-embedded human tonsil tissue stained for NOP58 using ab236724 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-NOP58 antibody (ab236724) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 4 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 60 kDa

  • All lanes : Anti-NOP58 antibody (ab236724) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 60 kDa

  • Paraffin-embedded human liver cancer tissue stained for NOP58 using ab236724 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NOP58 (green) using ab236724 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236724 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236724.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up