Overview

  • Product name

    Anti-Noradrenaline transporter antibody [CL3063]
    See all Noradrenaline transporter primary antibodies
  • Description

    Mouse monoclonal [CL3063] to Noradrenaline transporter
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Noradrenaline transporter aa 159-230.
    Sequence:

    SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFT PAAEFYERGVLHLHESSGIHDI


    Database link: P23975

  • Epitope

    This antibody binds to an epitope located within the peptide sequence HTKYSKYKFTPAAEF (aa 199-213)
  • Positive control

    • Rat locus coeruleus and cerebral cortex, mouse cerebral cortex and hippocampal formation, human prostate and locus coeruleus tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab211463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Amine transporter. Terminates the action of noradrenaline by its high affinity sodium-dependent reuptake into presynaptic terminals.
  • Involvement in disease

    Orthostatic intolerance
  • Sequence similarities

    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A2 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • NAT1 antibody
    • NET antibody
    • NET1 antibody
    • Neurotransmitter transporter antibody
    • Norepinephrine transporter antibody
    • SC6A2_HUMAN antibody
    • Slc6a2 antibody
    • SLC6A5 antibody
    • Sodium dependent noradrenaline transporter antibody
    • Sodium-dependent noradrenaline transporter antibody
    • Solute carrier family 6 (neurotransmitter transporter norepinephrine) member 5 antibody
    • Solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2 antibody
    • Solute carrier family 6 member 2 antibody
    • Solute carrier family 6 member 5 antibody
    see all

Images

  • Immunohistochemical analysis of rat locus coeruleus tissue labeling Noradrenaline transporter with ab211463 at 1/500 dilution.

  • Immunohistochemical analysis of mouse cerebral cortex tissue labeling Noradrenaline transporter with ab211463 at 1/500 dilution.

  • Immunohistochemical analysis of human prostate tissue labeling Noradrenaline transporter with ab211463 at 1/500 dilution.

  • Immunohistochemical analysis of rat cerebral cortex tissue labeling Noradrenaline transporter with ab211463 at 1/500 dilution.

  • Immunohistochemical analysis of mouse hyppocampal formation tissue labeling Noradrenaline transporter with ab211463 at 1/500 dilution.

  • Immunohistochemical analysis of human locus coeruleus tissue labeling Noradrenaline transporter with ab211463 at 1/500 dilution.

  • Negative control: Immunohistochemical analysis of human kidney tissue labeling Noradrenaline transporter with ab211463 at 1/500 dilution.

References

ab211463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up