Overview

  • Product name

  • Description

    Rabbit polyclonal to Norbin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human Norbin aa 624-721.
    Sequence:

    PEYEGIWADLQELWFLGMQAFTGCVPLLPWLAPAALRSRWPQELLQLLGS VSPNSVKPEMVAAYQGVLVELARANRLCREAMRLQAGEETASHYRMAA


    Database link: Q9UBB6

  • Positive control

    • IHC-P: Human cerebral cortex tissue. WB: NIH/3T3 and NBT-II cell lysate; human cerebral cortex tissue lysate. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 79 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Neurochondrin is a leucine rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin dependent protein kinase II phosphorylation and may be essential for spatial learning processes.
  • Cellular localization

    Cytoplasm. Cell projection, dendrite. Note: Localizes to somatic regions of neurons.
  • Database links

  • Alternative names

    • AU042419 antibody
    • KIAA0607 antibody
    • M-Sema F-associating protein of 75 kDa antibody
    • MGC93259 antibody
    • MMS10-AE antibody
    • Ms10ae antibody
    • NCDN antibody
    • NCDN-1 antibody
    • NCDN-2 antibody
    • Neurochondrin 1 antibody
    • Norbin antibody
    • OTTHUMP00000065369 antibody
    • OTTHUMP00000065370 antibody
    • OTTHUMP00000065371 antibody
    • Sfap75 antibody
    see all

Images

  • Paraffin embedded human cerebral cortex tissue stained for Norbin with ab224451 (1/500 dilution) in immunohistochemical analysis.

  • PFA-fixed/Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Norbin (green) using ab224451 (4 µg/ml) in ICC/IF.

  • Anti-Norbin antibody (ab224451) at 1/100 dilution + human cerebral cortex tissue lysate

    Predicted band size: 79 kDa

  • All lanes : Anti-Norbin antibody (ab224451) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat cell line) cell lysate

    Predicted band size: 79 kDa

References

ab224451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up