Anti-Norovirus Capsid protein VP1 antibody (ab92976)

Overview

  • Product name
    Anti-Norovirus Capsid protein VP1 antibody
  • Description
    Rabbit polyclonal to Norovirus Capsid protein VP1
  • Host species
    Rabbit
  • Specificity
    Species Reactivity: Norovirus Hu/Texas/TCH04-577/2004/US
  • Tested applications
    Suitable for: WB, ELISA, ICC/IFmore details
  • Species reactivity
    Reacts with: Other species
  • Immunogen

    Synthetic peptide corresponding to N terminal residues of Norovirus Capsid protein VP1

Properties

Applications

Our Abpromise guarantee covers the use of ab92976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. for 2 hours. This antibody has been tested in Western blot against the recombinant peptide used as an immunogen. We have no data on detection of endogenous protein.
ELISA 1/2000 - 1/5000.
ICC/IF 1/100.

Target

  • Relevance
    Norovirus is an RNA virus of the Caliciviridae taxonomic family, causes approximately 90% of epidemic non bacterial outbreaks of gastroenteritis around the world and is responsible for 50% of all foodborne outbreaks of gastroenteritis in the US. Norovirus affects people of all ages. The viruses are transmitted by faecally contaminated food or water and by person to person contact. Noroviruses contain a positive-sense RNA genome of approximately 7.5 kbp, encoding a major structural protein (VP1) of about 58~60 kDa and a minor capsid protein (VP2). The virus particles demonstrate an amorphous surface structure when visualized using electron microscopy and are between 27-38 nm in size. Capsid protein VP1 attaches virion to target cells by binding histo-blood group antigens present on gastroduodenal epithelial cells. Soluble capsid protein may play a role in viral immunoevasion. Capsid protein VP1 binds to histoblood group antigens at surface of target cells. The shell domain (S domain) contains elements essential for the formation of the icosahedron. The Protruding domain (P domain) is divided into subdomains P1 and P2. P domain interacts in dimeric contacts that increase the stability of the capsid and form the protrusions on the virion. An hypervariable region in P2 is thought to play an important role in receptor binding and immune reactivity.
  • Database links
    • Alternative names
      • VP1 antibody

    Images

    • Ab92976 staining Norovirus Capsid protein VP1 in RAW 264.7 cells by ICC/IF (Immunocytochemistry/Immunofluorescence). Cells were fixed with paraformaldehyde, permeabilized with Digitonin (50µg/ml) and blocked with 1% serum for 1 hour at 21°C. Samples were incubated with primary antibody (1/100 dilution) for 1 hour at 21°C. An Alexa Fluor® 488 Donkey Anti-Mouse was used as the secondary antibody at 1/1000 dilution.

      See Abreview

    References

    This product has been referenced in:
    • Lee W  et al. Vibrio vulnificus quorum-sensing molecule cyclo(Phe-Pro) inhibits RIG-I-mediated antiviral innate immunity. Nat Commun 9:1606 (2018). Read more (PubMed: 29686409) »
    • Zhang Y  et al. Antiviral activity of shikonin ester derivative PMM-034 against enterovirus 71 in vitro. Braz J Med Biol Res 50:e6586 (2017). Read more (PubMed: 28832767) »

    See all 6 Publications for this product

    Customer reviews and Q&As

    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Mouse Cell (RAW 264.7 (murine macrophage))
    Permeabilization
    Yes - Digitonin 50ug/ml
    Specification
    RAW 264.7 (murine macrophage)
    Blocking step
    Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 21°C
    Fixative
    Paraformaldehyde
    Username

    Abcam user community

    Verified customer

    Submitted Aug 10 2017

    Application
    Western blot
    Loading amount
    50 µg
    Gel Running Conditions
    Reduced Denaturing (8%)
    Sample
    Mouse Cell lysate - whole cell (macrophage cell line)
    Specification
    macrophage cell line
    Treatment
    MNV infection
    Blocking step
    BSA as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 5% · Temperature: RT°C
    Username

    Abcam user community

    Verified customer

    Submitted Oct 29 2014

    Thank you for contacting us.

    The antibodies have only been tested in ELISA. We do not have any data for western blotting.

    Several of these are monoclonal antibodies that are raised against various strains of Norovirus, and the epi...

    Read More

    Thank you for your inquiry.
    I translated your sequence into the following protein sequence:
    MRMSDGAAPKANGSEASGQDLVPTAVEQAVPIQPVAGAALAAPAAGQINQIDPWIFQNFVQCPLGEFSISPRNTPGEILFDLALGPGLNPYLAHLSAMYTGWVGNMEVQLVLAGNAFTAGKVVVALVPPYFPKGSLTTAQITCFPHVMCD...

    Read More

    Thank you for your reply. There is about a 74% similarity between your sequence the immunogen sequence that was used for ab92976. Normally we look for about an 85% similarity before recommending an antibody be used on an untested species. If you will s...

    Read More

    Unfortunately I cannot determine if the antibody will react with the strain that you are working on. If you could send me the sequence of your particular strain then I could determine if there is a significant match between that and the peptide sequenc...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up