Overview

  • Product name

    Anti-NOSTRIN antibody
  • Description

    Rabbit polyclonal to NOSTRIN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat NOSTRIN aa 1-245. (Expressed in E.coli).
    Sequence:

    MRDPLTDCSYNKVYKSLKEFAQNGDNFCKQITSVLQQRANLEISYAKGLQ KLAVKLSKALQSTKKNCLSTAWAWASESMKSAADLHQKLGKAIELEAIKP THQVLSMQEKKRKSLDNEVEKSANLVINNWNQQIKAKKKLMMSTKKHEAL FHLIESSKQSMTQKEKQKLLNKLKKSTEKLEKEDESYYQKNMAGYSTRLK WESTLEKCYKSMLELEKERIQLLCNNLNQYSQHISLFGQTLTTCH


    Database link: Q5I0D6

  • Positive control

    • IHC-P: Rat liver, skeletal muscle, kidney, stomach, small intestine, heart and spinal cord tissues. WB: Rat lung lysate; Recombinant rat NOSTRIN protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232751 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 57 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Multivalent adapter protein which may decrease NOS3 activity by inducing its translocation away from the plasma membrane.
  • Tissue specificity

    Expressed at highest levels in heart, kidney, placenta and lung, and at lowest levels in brain, thymus and spleen. Present in vascular endothelial cells and placenta. Over-expressed in placenta from women with pre-eclampsia (at protein level).
  • Sequence similarities

    Contains 1 FCH domain.
    Contains 1 SH3 domain.
  • Domain

    The SH3 domain mediates interaction with NOS3, DNM2 and WASL.
    The FCH domain is necessary for membrane targeting.
  • Cellular localization

    Cell membrane. Cytoplasmic vesicle. Cytoplasm > cytoskeleton. Enriched in selected actin structures.
  • Information by UniProt
  • Database links

  • Alternative names

    • BM247 antibody
    • BM247 homolog antibody
    • DaIP2 antibody
    • eNOS-trafficking inducer antibody
    • mDaIP2 antibody
    • MGC20702 antibody
    • Nitric oxide synthase traffic inducer antibody
    • Nitric oxide synthase trafficker antibody
    • NOSTN_HUMAN antibody
    • Nostrin antibody
    • RP23-431D4.2 antibody
    see all

Images

  • Paraffin-embedded rat liver tissue stained for NOSTRIN using ab232751 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat skeletal muscle tissue stained for NOSTRIN using ab232751 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat kidney tissue stained for NOSTRIN using ab232751 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for NOSTRIN using ab232751 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat small intestine tissue stained for NOSTRIN using ab232751 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat heart tissue stained for NOSTRIN using ab232751 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat spinal cord tissue stained for NOSTRIN using ab232751 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NOSTRIN antibody (ab232751) at 1 µg/ml + Recombinant rat NOSTRIN protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

  • Anti-NOSTRIN antibody (ab232751) at 1 µg/ml + Rat lung lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

References

ab232751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up