Overview

  • Product name

    Anti-Notch2 antibody [MM0845-48N11]
    See all Notch2 primary antibodies
  • Description

    Rat monoclonal [MM0845-48N11] to Notch2
  • Host species

    Rat
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Notch2 aa 2063-2412 (intracellular).
    Sequence:

    DEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMGKKSRRPSAKSTM PTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVS DTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAH GASTVLPSVSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNET QYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLIPK GSIAQPAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPSVAFPTAMMPQQD GQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEH


    Database link: Q04721

Properties

Applications

Our Abpromise guarantee covers the use of ab201616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 265 kDa.

Target

  • Function

    Functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs (By similarity). Involved in bone remodeling and homeostasis. In collaboration with RELA/p65 enhances NFATc1 promoter activity and positively regulates RANKL-induced osteoclast differentiation. Positively regulates self-renewal of liver cancer cells (PubMed:25985737).
  • Tissue specificity

    Expressed in the brain, heart, kidney, lung, skeletal muscle and liver. Ubiquitously expressed in the embryo.
  • Involvement in disease

    Alagille syndrome 2
    Hajdu-Cheney syndrome
  • Sequence similarities

    Belongs to the NOTCH family.
    Contains 6 ANK repeats.
    Contains 35 EGF-like domains.
    Contains 3 LNR (Lin/Notch) repeats.
  • Post-translational
    modifications

    Synthesized in the endoplasmic reticulum as an inactive form which is proteolytically cleaved by a furin-like convertase in the trans-Golgi network before it reaches the plasma membrane to yield an active, ligand-accessible form. Cleavage results in a C-terminal fragment N(TM) and a N-terminal fragment N(EC). Following ligand binding, it is cleaved by TNF-alpha converting enzyme (TACE) to yield a membrane-associated intermediate fragment called notch extracellular truncation (NEXT). This fragment is then cleaved by presenilin dependent gamma-secretase to release a notch-derived peptide containing the intracellular domain (NICD) from the membrane.
    Hydroxylated by HIF1AN.
    Can be either O-glucosylated or O-xylosylated at Ser-613 by POGLUT1.
  • Cellular localization

    Cell membrane and Nucleus. Cytoplasm. Following proteolytical processing NICD is translocated to the nucleus. Retained at the cytoplasm by C8orf4 (PubMed:25985737).
  • Information by UniProt
  • Database links

  • Alternative names

    • AGS2 antibody
    • hN2 antibody
    • Motch B antibody
    • N2 antibody
    • N2ECD antibody
    • N2ICD antibody
    • neurogenic locus notch homolog protein 2 antibody
    • NOTC2_HUMAN antibody
    • Notch 2 antibody
    • Notch 2 intracellular domain antibody
    • Notch Drosophila homolog 2 antibody
    • Notch homolog 2 antibody
    • Notch homolog 2 Drosophila antibody
    • Notch2 antibody
    see all

References

ab201616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up