Anti-NOX2/gp91phox antibody (ab180642)

Rabbit polyclonal NOX2/gp91phox antibody. Validated in WB, IHC and tested in Mouse, Rat, Human. Cited in 1 publication(s). Immunogen corresponding to recombinant fragment.

Overview

  • Product name

    Anti-NOX2/gp91phox antibody
    See all NOX2/gp91phox primary antibodies
  • Description

    Rabbit polyclonal to NOX2/gp91phox
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NOX2/gp91phox aa 283-570.
    Sequence:

    ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKV SKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKL PKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNAT NLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTG WDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRI GVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF


    Database link: P04839

  • Positive control

    • Jurkat whole cell lysate (ab7899) can be used as a positive control in WB. MCF7 cell line extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab180642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 65 kDa.

Target

  • Function

    Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
  • Involvement in disease

    Defects in CYBB are a cause of chronic granulomatous disease X-linked (XCGD) [MIM:306400]. Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections.
  • Sequence similarities

    Contains 1 FAD-binding FR-type domain.
    Contains 1 ferric oxidoreductase domain.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AMCBX2 antibody
    • CGD antibody
    • CGD91-phox antibody
    • CY24B_HUMAN antibody
    • CYBB antibody
    • Cytochrome b 245, beta polypeptide antibody
    • Cytochrome b(558) beta chain antibody
    • Cytochrome b(558) subunit beta antibody
    • Cytochrome b-245 heavy chain antibody
    • Cytochrome b558 subunit beta antibody
    • GP91 PHOX antibody
    • gp91-1 antibody
    • gp91-phox antibody
    • GP91PHOX antibody
    • Heme-binding membrane glycoprotein gp91phox antibody
    • NADPH oxidase 2 antibody
    • Neutrophil cytochrome b 91 kDa polypeptide antibody
    • NOX2 antibody
    • p22 phagocyte B-cytochrome antibody
    • P91 PHOX antibody
    • p91-PHOX antibody
    • Superoxide-generating NADPH oxidase heavy chain subunit antibody
    see all

References

This product has been referenced in:

  • Zhao YF  et al. The Synergy of Aging and LPS Exposure in a Mouse Model of Parkinson's Disease. Aging Dis 9:785-797 (2018). Read more (PubMed: 30271656) »
  • Sun HJ  et al. Salusin-ß Promotes Vascular Smooth Muscle Cell Migration and Intimal Hyperplasia After Vascular Injury via ROS/NF?B/MMP-9 Pathway. Antioxid Redox Signal 24:1045-57 (2016). Read more (PubMed: 26952533) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up