Overview

  • Product name

    Anti-NOX5 antibody - C-terminal
    See all NOX5 primary antibodies
  • Description

    Rabbit polyclonal to NOX5 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide within Human NOX5 (C terminal). The exact sequence is proprietary.
    Sequence:

    DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG


    Database link: Q96PH1-5

  • Positive control

    • Jurkat whole cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab178731 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Calcium-dependent NADPH oxidase that generates superoxide. Also functions as a calcium-dependent proton channel and may regulate redox-dependent processes in lymphocytes and spermatozoa. May play a role in cell growth and apoptosis.
  • Tissue specificity

    Mainly expressed in pachytene spermatocytes of testis and in lymphocyte-rich areas of spleen and lymph nodes. Isoform 3 is expressed in spleen. Isoform 4 is expressed in testis. Also detected in ovary, placenta, pancreas, cardiac fibroblasts. Expressed in B-cells and prostate malignant cells.
  • Sequence similarities

    Contains 4 EF-hand domains.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 ferric oxidoreductase domain.
  • Developmental stage

    Expressed in fetal tissues.
  • Domain

    Isoform 3 and isoform 4 of this protein have four functional EF-hand calcium-binding domains. Isoform 1 and isoform 2 have the third EF-hand domain interrupted by an insert.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC149776 antibody
    • MGC149777 antibody
    • NADPH oxidase 5 antibody
    • NADPH oxidase EFhand calcium binding domain 5 antibody
    • NOX5 antibody
    • NOX5_HUMAN antibody
    see all

Images

  • Anti-NOX5 antibody - C-terminal (ab178731) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size: 65 kDa

References

This product has been referenced in:

  • Dho SH  et al. NOX5-L can stimulate proliferation and apoptosis depending on its levels and cellular context, determining cancer cell susceptibility to cisplatin. Oncotarget 6:39235-46 (2015). Read more (PubMed: 26513170) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178731.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up