Overview

  • Product name

    Anti-Noxa antibody [ABM46B8]
    See all Noxa primary antibodies
  • Description

    Rat monoclonal [ABM46B8] to Noxa
  • Host species

    Rat
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Mouse Noxa aa 1-103.
    Sequence:

    MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQM PGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFN LVT


    Database link: Q9JM54

  • Positive control

    • T98G lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab220177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 - 4 µg/ml. Predicted molecular weight: 12 kDa.

Predicted Band: 6kDa (Human)

Target

  • Function

    Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1 (By similarity). Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1.
  • Tissue specificity

    Highly expressed in adult T-cell leukemia cell line.
  • Sequence similarities

    Belongs to the PMAIP1 family.
  • Domain

    The BH3 motif is essential for pro-apoptotic activity.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adult T cell leukemia derived PMA responsive antibody
    • APR antibody
    • APR_HUMAN antibody
    • ATL-derived antibody
    • Immediate early response protein APR antibody
    • Immediate-early-response protein APR antibody
    • NOXA antibody
    • Phorbol 12 myristate 13 acetate induced protein 1 antibody
    • Phorbol-12-myristate-13-acetate-induced protein 1 antibody
    • PMA induced protein 1 antibody
    • PMA-induced protein 1 antibody
    • PMA-responsive gene antibody
    • Pmaip1 antibody
    • Protein Noxa antibody
    see all

Images

  • Anti-Noxa antibody [ABM46B8] (ab220177) at 1 µg/ml + T98G lysate

    Predicted band size: 12 kDa

References

ab220177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up