Overview

  • Product name
    Anti-NOXA2/p67phox antibody
    See all NOXA2/p67phox primary antibodies
  • Description
    Rabbit polyclonal to NOXA2/p67phox
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human NOXA2/p67phox aa 1-526.
    Sequence:

    MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTIL KNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQ LRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSM KSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLAKKDYLG KATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFG FVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELR IHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPM PYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSN ELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQ TTEPQLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKVNEEWLEGECK GKVGIFPKVFVEDCATTDLESTRREV


    Database link: P19878

  • Positive control
    • THP1 cell and spleen cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab175293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 60 kDa.

Target

  • Function
    NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).
  • Involvement in disease
    Defects in NCF2 are a cause of chronic granulomatous disease autosomal recessive cytochrome-b-positive type 2 (CGD2) [MIM:233710]. Chronic granulomatous disease is a genetically heterogeneous disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life-threatening bacterial/fungal infections.
  • Sequence similarities
    Belongs to the NCF2/NOXA1 family.
    Contains 1 OPR domain.
    Contains 2 SH3 domains.
    Contains 3 TPR repeats.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 67 kDa neutrophil oxidase factor antibody
    • Chronic granulomatous disease autosomal 2 antibody
    • FLJ93058 antibody
    • NADPH oxidase activator 2 antibody
    • NCF-2 antibody
    • Ncf2 antibody
    • NCF2_HUMAN antibody
    • Neutrophil cytosol factor 2 antibody
    • Neutrophil cytosolic factor 2 (65kD, chronic granulomatous disease, autosomal 2) antibody
    • Neutrophil NADPH oxidase factor 2 antibody
    • NOXA2 antibody
    • P67 PHOX antibody
    • p67-phox antibody
    • p67phox antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophagus tissue labelling NOXA2/p67phox with ab175293 at 1/100. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophageal cancer tissue labelling NOXA2/p67phox with ab175293 at 1/100. Magnification: 400x.
  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175293. Blue DAPI for nuclear staining.
  • All lanes : Anti-NOXA2/p67phox antibody (ab175293) at 1/500 dilution

    Lane 1 : THP1 cell lysate
    Lane 2 : spleen cell lysate

    Predicted band size: 60 kDa

References

ab175293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up