Overview

  • Product name

  • Description

    Rabbit polyclonal to NPAS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide within Human NPAS3 aa 41-90 (internal sequence). The exact sequence is proprietary.
    Sequence:

    CESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK


    Database link: Q8IXF0-6

  • Positive control

    • THP1 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.

Target

Images

  • Anti-NPAS3 antibody (ab179611) at 1 µg/ml + THP1 whole cell lysate at 10 µg

    Predicted band size: 29 kDa

References

ab179611 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
20 µg
Gel Running Conditions
Reduced Denaturing
Sample
Mouse Tissue lysate - whole (hippocampus)
Specification
hippocampus
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Jin-Young Koh

Verified customer

Submitted Aug 18 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up