Overview

  • Product name

  • Description

    Rabbit polyclonal to Npas4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Npas4 aa 401-493.
    Sequence:

    YLTFPSGPEPSLQAELSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPT PSSTLQEQLTPSTATFSDQLTPSSATFPDPLTSPLQGQLTETS


    Database link: Q8IUM7

  • Positive control

    • IHC-P: Human cerebral cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab247014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acts as a transcriptional activator in the presence of ARNT. Can activate the CME (CNS midline enhancer) element and the expression of the drebrin gene.
  • Tissue specificity

    Brain.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLH PAS type transcription factor NXF antibody
    • bHLHe79 antibody
    • Class E basic helix-loop-helix protein 79 antibody
    • HLH-PAS transcription factor NXF antibody
    • Le PAS antibody
    • limbic enhanced PAS protein antibody
    • neuronal PAS domain protein 4 antibody
    • Neuronal PAS domain-containing protein 4 antibody
    • Neuronal PAS4 antibody
    • NPAS4 antibody
    • NPAS4_HUMAN antibody
    • NXF antibody
    • PAS domain-containing protein 10 antibody
    • PASD10 antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for Npas4 using ab247014 at 1/50 dilution in immunohistochemical analysis.

References

ab247014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab247014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up