Overview

  • Product name

    Anti-Npas4 antibody [S408-79]
    See all Npas4 primary antibodies
  • Description

    Mouse monoclonal [S408-79] to Npas4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Fusion protein corresponding to Rat Npas4 aa 597-802.
    Sequence:

    PLSVDVPLVPEGLLTPEASPVKQSFFHYTEKEQNEIDRLIQQISQLAQGM DRPFSAEAGTGGLEPLGGLEPLNPNLSLSGAGPPVLSLDLKPWKCQELDF LVDPDNLFLEETPVEDIFMDLSTPDPNGEWGSGDPEAEVPGGTLSPCNNL SPEDHSFLEDLATYETAFETGVSTFPYEGFADELHQLQSQVQDSFHEDGS GGEPTF


    Database link: Q8CJH6

  • Positive control

    • WB: Rat brain lysate. ICC/IF: SK-N-BE cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab242003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 87 kDa.
ICC/IF 1/100.

Target

  • Function

    Acts as a transcriptional activator in the presence of ARNT. Can activate the CME (CNS midline enhancer) element and the expression of the drebrin gene.
  • Tissue specificity

    Brain.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLH PAS type transcription factor NXF antibody
    • bHLHe79 antibody
    • Class E basic helix-loop-helix protein 79 antibody
    • HLH-PAS transcription factor NXF antibody
    • Le PAS antibody
    • limbic enhanced PAS protein antibody
    • neuronal PAS domain protein 4 antibody
    • Neuronal PAS domain-containing protein 4 antibody
    • Neuronal PAS4 antibody
    • NPAS4 antibody
    • NPAS4_HUMAN antibody
    • NXF antibody
    • PAS domain-containing protein 10 antibody
    • PASD10 antibody
    see all

Images

  • 4% formaldehyde-fixed SK-N-BE (human neuroblastoma cell line) cells stained for Npas4 (green, C) using ab242003 at 1/100 dilution for 1 hour at room temperature in ICC/IF. Secondary antibody is Goat Anti-Mouse ATTO 488 at 1/100 dilution for 1 hr at RT. Actin is detected with Phalloidin Texas Red F-Actin stain (red, B). The nuclear counterstain is DAPI (blue, A). (D) is a composite image.

  • Anti-Npas4 antibody [S408-79] (ab242003) at 1/1000 dilution + Rat brain tissue lysate at 20 µg

    Secondary
    Goat Anti-Mouse IgG: HRP at 1/200 dilution

    Developed using the ECL technique.

    Predicted band size: 87 kDa


    Exposure time: 6 minutes


    Primary incubation for 16 hours at 4°C.

    Secondary incubatin for 1 hr at RT.

    Blocked for 1 hr at RT.

References

ab242003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up