Overview

  • Product name

  • Description

    Rabbit polyclonal to NPEPPS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human NPEPPS aa 584-793.
    Sequence:

    GTVGFYRTQYSSAMLESLLPGIRDLSLPPVDRLGLQNDLFSLARAGIIST VEVLKVMEAFVNEPNYTVWSDLSCNLGILSTLLSHTDFYEEIQEFVKDVF SPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGHKATLEEARRRFKDHV EGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVL GATLLPDLIQ


    Database link: P55786

  • Positive control

    • WB: Recombinant human NPEPPS; Pig brain lysate; Human lung tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.05% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 103 kDa.

Target

  • Function

    Aminopeptidase with broad substrate specificity for several peptides. Involved in proteolytic events essential for cell growth and viability. May act as regulator of neuropeptide activity. Plays a role in the antigen-processing pathway for MHC class I molecules. Involved in the N-terminal trimming of cytotoxic T-cell epitope precursors. Digests the poly-Q peptides found in many cellular proteins. Digests tau from normal brain more efficiently than tau from Alzheimer disease brain.
  • Tissue specificity

    Detected in liver, epithelium of renal tubules, epithelium of small and large intestine, gastric epithelial cells, and alveoli of the lung (at protein level).
  • Sequence similarities

    Belongs to the peptidase M1 family.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AAP-S antibody
    • Aminopeptidase puromycin sensitive antibody
    • Cytosol alanyl aminopeptidase antibody
    • Metalloprotease 100 antibody
    • Metalloprotease MP100 antibody
    • MP 100 antibody
    • MP100 antibody
    • Npepps antibody
    • Psa antibody
    • PSA_HUMAN antibody
    • Puromycin sensitive aminopeptidase antibody
    • Puromycin-sensitive aminopeptidase antibody
    see all

Images

  • Anti-NPEPPS antibody (ab231979) at 2 µg/ml + Recombinant human NPEPPS protein

    Developed using the ECL technique.

    Predicted band size: 103 kDa

  • All lanes : Anti-NPEPPS antibody (ab231979) at 2 µg/ml

    Lane 1 : Porcine brain tissue lysate
    Lane 2 : Human lung tissue lysate

    Developed using the ECL technique.

    Predicted band size: 103 kDa

References

ab231979 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up