Overview

  • Product name

  • Description

    Rabbit polyclonal to NPP-7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Rat NPP-7 aa 22-439. (Expressed in E.coli).
    Sequence:

    GPVQRQQQHKLLLVSFDGFRWNYDQDVETPNLDSMAQEGVKARYMTPAFV TMTSPCHFTLVTGKYIENHGVVHNMFYNTTNKVRLPYHATLGIQRWWDNG SIPIWITAQRQGLKTGSFFYPGGNVTYQGEAVTMSRKEGVLHNYKNETEW RANVDTVMKWFTEEDVSLVTLYFGEPDSTGHKYGPESQERKDMVKQVDRT VGYLRDSIKRHHLTDSLNLIITSDHGMTTVNKKASDLVEFHKFPNFTFRD IEFELLDYGPNGMLIPKEGMLEKVYSVLKDAHPRLHVYKKEDFPKTFHYA NNPRITSLLMYSDLGYVIHGRVNVQFNSGEHGFDNQDMDMKTIFRAVGPS FKAGLEVEPFESVHVYELMCQLLGIVPEPNDGHPGVLQPMLRSGSPLSRQ HHLVVVLMGILTGLAKVV


    Database link: Q5EZ72

  • Positive control

    • WB: Recombinant rat NPP-7 and rat liver tissue lysate. IHC-P: Rat intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 50 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Converts sphingomyelin to ceramide. Also has phospholipase C activity toward palmitoyl lyso-phosphocholine. Does not appear to have nucleotide pyrophosphatase activity.
  • Tissue specificity

    Detected in the colon (at protein level). Expressed in the duodenum, jejunum and liver and at low levels in the ileum. Expression was very low in the esophagus, stomach and colon.
  • Sequence similarities

    Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.
  • Post-translational
    modifications

    N-glycosylated; required for activity and transport to the plasma membrane.
  • Cellular localization

    Membrane. Localized at the surface of the microvillar membrane in small intestine enterocytes, and in endosome-like structures situated beneath the microvillar membrane, and in Golgi complex.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALK SMase antibody
    • Alk-SMase antibody
    • Alkaline sphingomyelin phosphodiesterase antibody
    • E-NPP 7 antibody
    • Ectonucleotide pyrophosphatase/phosphodiesterase 7 antibody
    • Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 antibody
    • ENPP7 antibody
    • ENPP7_HUMAN antibody
    • Intestinal alkaline sphingomyelinase antibody
    • NPP-7 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat intestine tissue stained for NPP-7 using ab231811 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NPP-7 antibody (ab231811) at 2 µg/ml + Recombinant rat NPP-7

    Predicted band size: 50 kDa

  • Anti-NPP-7 antibody (ab231811) at 2 µg/ml + Rat liver lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/1000 dilution

    Predicted band size: 50 kDa

References

ab231811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up