Anti-NPR-C antibody (ab262842)
Key features and details
- Rabbit polyclonal to NPR-C
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-NPR-C antibody
See all NPR-C primary antibodies -
Description
Rabbit polyclonal to NPR-C -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human NPR-C aa 330-474.
Sequence:PEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRAG YSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQ EVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCK
Database link: P17342 -
Positive control
- IHC-P: Human kidney tissue. ICC/IF: HeLa cells
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab262842 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Receptor for the natriuretic peptide hormones, binding with similar affinities atrial natriuretic peptide NPPA/ANP, brain natriuretic peptide NPPB/BNP, and C-type natriuretic peptide NPPC/CNP. May function as a clearance receptor for NPPA, NPPB and NPPC, regulating their local concentrations and effects. May regulate diuresis, blood pressure and skeletal development. Does not have guanylate cyclase activity. -
Sequence similarities
Belongs to the ANF receptor family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4883 Human
- Omim: 108962 Human
- SwissProt: P17342 Human
- Unigene: 237028 Human
- Unigene: 619466 Human
-
Alternative names
- ANP C antibody
- ANP-C antibody
- ANPC antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized human HeLa cells stained for NPR-C (green) using ab262842 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NPR-C antibody (ab262842)Paraffin-embedded human Human kidney tissue stained for NPR-C using ab262842 at 1/50 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab262842 has not yet been referenced specifically in any publications.