Overview

  • Product name

    Anti-NPY6R antibody
  • Description

    Rabbit polyclonal to NPY6R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NPY6R aa 1-39.
    Sequence:

    MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLC


    Database link: Q99463

  • Positive control

    • WB: Mouse and rat brain lysates. IHC-P: Human skeletal muscle and kidney lysates. ICC/IF: MCF7 cells.
  • General notes

    Previously labelled as Neuropeptide Y Receptor Type 6.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab223515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 34 kDa (predicted molecular weight: 33 kDa).
IHC-P 1/20 - 1/200.

Target

  • Database links

  • Alternative names

    • Neuropeptide Y Receptor Type 6 antibody
    • Neuropeptide Y receptor Y6 (pseudogene) antibody
    • NPY1RL antibody
    • NPY6R antibody
    • NPY6RP antibody
    • PP2 antibody
    • Putative neuropeptide Y receptor type 6 antibody
    • Y2B antibody
    see all

Images

  • MCF7 (human breast adenocarcinoma cell line) cells stained for NPY6R (green) using ab223515 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human kidney tissue stained for NPY6R using ab223515 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skeletal muscle tissue stained for NPY6R using ab223515 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-NPY6R antibody (ab223515) at 1/500 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Rat brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 33 kDa

References

ab223515 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up