Anti-NQO1 antibody (ab217302)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-NQO1 antibody
See all NQO1 primary antibodies -
Description
Rabbit polyclonal to NQO1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human
-
Immunogen
Synthetic peptide within Human NQO1 aa 240-274 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:KKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK
Database link: P15559 -
Positive control
- Mouse colon carcinoma tissue; Rat liver and brain lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab217302 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/1000. Predicted molecular weight: 31 kDa. | |
| IHC-P | 1/100 - 1/500. |
Target
-
Function
The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. -
Sequence similarities
Belongs to the NAD(P)H dehydrogenase (quinone) family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 1728 Human
- Entrez Gene: 18104 Mouse
- Entrez Gene: 24314 Rat
- Omim: 125860 Human
- SwissProt: P15559 Human
- SwissProt: Q64669 Mouse
- SwissProt: P05982 Rat
- Unigene: 406515 Human
see all -
Alternative names
- Azoreductase antibody
- Cytochrome b 5 reductase antibody
- DHQU antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NQO1 antibody (ab217302)Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling NQO1 with ab217302 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Western blot - Anti-NQO1 antibody (ab217302)All lanes : Anti-NQO1 antibody (ab217302) at 1/200 dilution
Lane 1 : Rat liver lysate
Lane 2 : Rat brain lysate
Secondary
All lanes : Goat Anti-Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution
Predicted band size: 31 kDa
Observed band size: 30 kDa why is the actual band size different from the predicted?
Datasheets and documents
References
This product has been referenced in:
- Liu X et al. Effects of ginsenoside Rb1 on oxidative stress injury in rat spinal cords by regulating the eNOS/Nrf2/HO-1 signaling pathway. Exp Ther Med 16:1079-1086 (2018). Read more (PubMed: 30116359) »
