For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    nqo1-antibody-ab217302.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Drug metabolism
Share by email

Anti-NQO1 antibody (ab217302)

  • Datasheet
Submit a review Submit a question References (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NQO1 antibody (ab217302)
  • Western blot - Anti-NQO1 antibody (ab217302)

Key features and details

  • Rabbit polyclonal to NQO1
  • Suitable for: WB, IHC-P
  • Reacts with: Mouse, Rat
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Protein
Product image
Recombinant Human NQO1 protein (ab87692)

View more associated products

Overview

  • Product name

    Anti-NQO1 antibody
    See all NQO1 primary antibodies
  • Description

    Rabbit polyclonal to NQO1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human NQO1 aa 240-274 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    KKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK


    Database link: P15559
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Mouse colon carcinoma tissue; Rat liver and brain lysates.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Metabolism
    • Drug metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Drug metabolism

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human NQO1 protein (ab87692)
  • Related Products

    • Recombinant Human NQO1 protein (ab87692)

Applications

Our Abpromise guarantee covers the use of ab217302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 31 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
  • Sequence similarities

    Belongs to the NAD(P)H dehydrogenase (quinone) family.
  • Cellular localization

    Cytoplasm.
  • Target information above from: UniProt accession P15559 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 1728 Human
    • Entrez Gene: 18104 Mouse
    • Entrez Gene: 24314 Rat
    • Omim: 125860 Human
    • SwissProt: P15559 Human
    • SwissProt: Q64669 Mouse
    • SwissProt: P05982 Rat
    • Unigene: 406515 Human
    • Unigene: 252 Mouse
    • Unigene: 11234 Rat
    see all
  • Alternative names

    • Azoreductase antibody
    • Cytochrome b 5 reductase antibody
    • DHQU antibody
    • DIA 4 antibody
    • DIA4 antibody
    • Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody
    • Diaphorase (NADH/NADPH) antibody
    • Diaphorase 4 antibody
    • Dioxin inducible 1 antibody
    • DT diaphorase antibody
    • DT-diaphorase antibody
    • DTD antibody
    • Menadione reductase antibody
    • NAD(P)H dehydrogenase [quinone] 1 antibody
    • NAD(P)H dehydrogenase quinone 1 antibody
    • NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody
    • NAD(P)H quinone dehydrogenase 1 antibody
    • NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody
    • NAD(P)H:menadione oxidoreductase 1 antibody
    • NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody
    • NAD(P)H:quinone oxidoreductase 1 antibody
    • NAD(P)H:quinone oxireductase antibody
    • NMOR 1 antibody
    • NMOR I antibody
    • NMOR1 antibody
    • NMORI antibody
    • NQO 1 antibody
    • NQO1 antibody
    • NQO1_HUMAN antibody
    • Phylloquinone reductase antibody
    • QR 1 antibody
    • QR1 antibody
    • Quinone reductase 1 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NQO1 antibody (ab217302)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NQO1 antibody (ab217302)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling NQO1 with ab217302 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Western blot - Anti-NQO1 antibody (ab217302)
    Western blot - Anti-NQO1 antibody (ab217302)
    All lanes : Anti-NQO1 antibody (ab217302) at 1/200 dilution

    Lane 1 : Rat liver lysate
    Lane 2 : Rat brain lysate

    Secondary
    All lanes : Goat Anti-Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 31 kDa
    Observed band size: 30 kDa
    why is the actual band size different from the predicted?

Protocols

  • Western blot protocols
  • Immunohistochemistry protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (2)

    Publishing research using ab217302? Please let us know so that we can cite the reference in this datasheet.

    ab217302 has been referenced in 2 publications.

    • Xiao X  et al. LncRNA ENST00000453774.1 contributes to oxidative stress defense dependent on autophagy mediation to reduce extracellular matrix and alleviate renal fibrosis. J Cell Physiol 234:9130-9143 (2019). PubMed: 30317629
    • Liu X  et al. Effects of ginsenoside Rb1 on oxidative stress injury in rat spinal cords by regulating the eNOS/Nrf2/HO-1 signaling pathway. Exp Ther Med 16:1079-1086 (2018). PubMed: 30116359

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab217302.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.