Anti-NQO1 antibody (ab217302)
Key features and details
- Rabbit polyclonal to NQO1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-NQO1 antibody
See all NQO1 primary antibodies -
Description
Rabbit polyclonal to NQO1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Human -
Immunogen
Synthetic peptide within Human NQO1 aa 240-274 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:KKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK
Database link: P15559 -
Positive control
- Mouse colon carcinoma tissue; Rat liver and brain lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab217302 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/100 - 1/1000. Predicted molecular weight: 31 kDa. | |
IHC-P | 1/100 - 1/500. |
Target
-
Function
The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. -
Sequence similarities
Belongs to the NAD(P)H dehydrogenase (quinone) family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 1728 Human
- Entrez Gene: 18104 Mouse
- Entrez Gene: 24314 Rat
- Omim: 125860 Human
- SwissProt: P15559 Human
- SwissProt: Q64669 Mouse
- SwissProt: P05982 Rat
- Unigene: 406515 Human
see all -
Alternative names
- Azoreductase antibody
- Cytochrome b 5 reductase antibody
- DHQU antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NQO1 antibody (ab217302)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling NQO1 with ab217302 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
All lanes : Anti-NQO1 antibody (ab217302) at 1/200 dilution
Lane 1 : Rat liver lysate
Lane 2 : Rat brain lysate
Secondary
All lanes : Goat Anti-Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution
Predicted band size: 31 kDa
Observed band size: 30 kDa why is the actual band size different from the predicted?
Protocols
Datasheets and documents
References (2)
ab217302 has been referenced in 2 publications.
- Xiao X et al. LncRNA ENST00000453774.1 contributes to oxidative stress defense dependent on autophagy mediation to reduce extracellular matrix and alleviate renal fibrosis. J Cell Physiol 234:9130-9143 (2019). PubMed: 30317629
- Liu X et al. Effects of ginsenoside Rb1 on oxidative stress injury in rat spinal cords by regulating the eNOS/Nrf2/HO-1 signaling pathway. Exp Ther Med 16:1079-1086 (2018). PubMed: 30116359