Overview

  • Product name

  • Description

    Rabbit polyclonal to NQO2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human NQO2 aa 1-231.
    Sequence:

    MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPR ATDKDITGTLSNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIF QFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQGKLALLSVTTG GTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEE RKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ


    Database link: P16083

  • Positive control

    • WB: K562 whole cell lysate; Mouse liver lysate. IHC-P: Human brain tissue. ICC/IF: HeLa cells. IP: K562 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 26 kDa.

Target

  • Function

    The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
  • Sequence similarities

    Belongs to the NAD(P)H dehydrogenase (quinone) family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • DHQV antibody
    • DIA6 antibody
    • EC 1.10.99.2 antibody
    • MGC94180 antibody
    • NAD(P)H dehydrogenase quinone 2 antibody
    • NAD(P)H menadione oxidoreductase 1 dioxin inducible 2 antibody
    • NAD(P)H menadione oxidoreductase 2 dioxin inducible antibody
    • NMOR2 antibody
    • NQO 2 antibody
    • NQO2 antibody
    • NQO2_HUMAN antibody
    • NRH dehydrogenase [quinone] 2 antibody
    • NRH dehydrogenase antibody
    • NRH:quinone oxidoreductase 2 antibody
    • OTTHUMP00000015948 antibody
    • OTTHUMP00000015949 antibody
    • OTTHUMP00000015953 antibody
    • Ox 2 antibody
    • Ox2 antibody
    • QR2 antibody
    • Quinone antibody
    • Quinone reductase 2 antibody
    • Ribosyldihydronicotinamide dehydrogenase [quinone] antibody
    • Ribosyldihydronicotinamide dehydrogenase antibody
    see all

Images

  • All lanes : Anti-NQO2 antibody (ab236917) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 2 : Mouse liver lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 26 kDa

  • Paraffin-embedded human brain tissue stained for NQO2 using ab236917 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NQO2 (green) using ab236917 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • NQO2 was immunoprecipitated from 500 µg K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate with ab236917 at 1/200 dilution. 

    Lane 1: Rabbit control IgG IP in K562 whole cell lysate.

    Lane 2: ab236917 IP in K562 whole cell lysate.

    Lane 3: K562 whole cell lysate 10 µg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab236917 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up