Anti-NQO2 antibody (ab236917)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-NQO2 antibody
See all NQO2 primary antibodies -
Description
Rabbit polyclonal to NQO2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IP, IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Orangutan
-
Immunogen
Recombinant full length protein corresponding to Human NQO2 aa 1-231.
Sequence:MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPR ATDKDITGTLSNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIF QFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQGKLALLSVTTG GTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEE RKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Database link: P16083 -
Positive control
- WB: K562 whole cell lysate; Mouse liver lysate. IHC-P: Human brain tissue. ICC/IF: HeLa cells. IP: K562 whole cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236917 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | 1/50 - 1/200. | |
| IP | 1/200 - 1/2000. | |
| IHC-P | 1/20 - 1/200. | |
| WB | 1/500 - 1/5000. Predicted molecular weight: 26 kDa. |
Target
-
Function
The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. -
Sequence similarities
Belongs to the NAD(P)H dehydrogenase (quinone) family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 4835 Human
- Entrez Gene: 18105 Mouse
- Omim: 160998 Human
- SwissProt: P16083 Human
- SwissProt: Q9JI75 Mouse
- SwissProt: Q5RBB9 Orangutan
- Unigene: 533050 Human
- Unigene: 264036 Mouse
-
Alternative names
- DHQV antibody
- DIA6 antibody
- EC 1.10.99.2 antibody
see all
Images
-
Western blot - Anti-NQO2 antibody (ab236917)All lanes : Anti-NQO2 antibody (ab236917) at 1/500 dilution
Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
Lane 2 : Mouse liver lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 26 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NQO2 antibody (ab236917)Paraffin-embedded human brain tissue stained for NQO2 using ab236917 at 1/100 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-NQO2 antibody (ab236917)HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NQO2 (green) using ab236917 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunoprecipitation - Anti-NQO2 antibody (ab236917)NQO2 was immunoprecipitated from 500 µg K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate with ab236917 at 1/200 dilution.
Lane 1: Rabbit control IgG IP in K562 whole cell lysate.
Lane 2: ab236917 IP in K562 whole cell lysate.
Lane 3: K562 whole cell lysate 10 µg (Input).
For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.
References
ab236917 has not yet been referenced specifically in any publications.
