Anti-NQO2 antibody (ab236917)
Key features and details
- Rabbit polyclonal to NQO2
- Suitable for: ICC/IF, IP, IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-NQO2 antibody
See all NQO2 primary antibodies -
Description
Rabbit polyclonal to NQO2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IP, IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Orangutan
-
Immunogen
Recombinant full length protein corresponding to Human NQO2 aa 1-231.
Sequence:MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPR ATDKDITGTLSNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIF QFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQGKLALLSVTTG GTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEE RKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Database link: P16083 -
Positive control
- WB: K562 whole cell lysate; Mouse liver lysate. IHC-P: Human brain tissue. ICC/IF: HeLa cells. IP: K562 whole cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol, PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236917 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | 1/50 - 1/200. | |
| IP | 1/200 - 1/2000. | |
| IHC-P | 1/20 - 1/200. | |
| WB | 1/500 - 1/5000. Predicted molecular weight: 26 kDa. |
Target
-
Function
The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. -
Sequence similarities
Belongs to the NAD(P)H dehydrogenase (quinone) family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 4835 Human
- Entrez Gene: 18105 Mouse
- Omim: 160998 Human
- SwissProt: P16083 Human
- SwissProt: Q9JI75 Mouse
- SwissProt: Q5RBB9 Orangutan
- Unigene: 533050 Human
- Unigene: 264036 Mouse
-
Alternative names
- DHQV antibody
- DIA6 antibody
- EC 1.10.99.2 antibody
see all
Images
-
Western blot - Anti-NQO2 antibody (ab236917)All lanes : Anti-NQO2 antibody (ab236917) at 1/500 dilution
Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
Lane 2 : Mouse liver lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 26 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NQO2 antibody (ab236917)Paraffin-embedded human brain tissue stained for NQO2 using ab236917 at 1/100 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-NQO2 antibody (ab236917)HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NQO2 (green) using ab236917 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunoprecipitation - Anti-NQO2 antibody (ab236917)NQO2 was immunoprecipitated from 500 µg K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate with ab236917 at 1/200 dilution.
Lane 1: Rabbit control IgG IP in K562 whole cell lysate.
Lane 2: ab236917 IP in K562 whole cell lysate.
Lane 3: K562 whole cell lysate 10 µg (Input).
For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236917 has not yet been referenced specifically in any publications.
