Overview

  • Product name

  • Description

    Rabbit polyclonal to NR0B2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human NR0B2 aa 1-257. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLC APHRTCREALDVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGL AQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQ CCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLC EVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLL GDMLLLR


    Database link: Q15466

  • Positive control

    • IHC-P: Human liver tissue. WB: Recombinant human NR0B2 protein; Pig kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Acts as a transcriptional regulator. Acts as a negative regulator of receptor-dependent signaling pathways. Specifically inhibits transactivation of the nuclear receptor with whom it interacts. Inhibits transcriptional activity of NEUROD1 on E-box-containing promoter by interfering with the coactivation function of the p300/CBP-mediated trancription complex for NEUROD1.
  • Tissue specificity

    Liver. Low levels of expression were detected in heart and pancreas.
  • Involvement in disease

    Obesity
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR0 subfamily.
  • Post-translational
    modifications

    Arginine methylation by PRMT5 enhances repression activity of metabolic genes in liver in response to bile acid signaling, by increasing interaction with cofactors.
  • Cellular localization

    Nucleus. Cytoplasm. Colocalizes with NEUROD1 in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NR0B2 antibody
    • NR0B2_HUMAN antibody
    • Nr0b2a antibody
    • Nuclear receptor subfamily 0 group B member 2 antibody
    • Nuclear receptor subfamily 0, group B, member 2a antibody
    • Orphan nuclear receptor SHP antibody
    • SHP antibody
    • SHP-1 antibody
    • Shp1 antibody
    • Small heterodimer partner antibody
    see all

Images

  • Anti-NR0B2 antibody (ab232841) at 1 µg/ml + Pig kidney tissue lysate.
  • Anti-NR0B2 antibody (ab232841) at 2 µg/ml + Recombinant human NR0B2 protein.
  • Formalin-fixed, paraffin-embedded human liver tissue stained for NR0B2 using ab232841 at 20 µg/mL in immunohistochemical analysis. DAB staining.  

References

ab232841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232841.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up