Overview

  • Product name

  • Description

    Rabbit polyclonal to NR1D1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Cow
  • Immunogen

    Recombinant fragment corresponding to Human NR1D1 aa 246-558.
    Sequence:

    TPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARA HREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNT LAAQRHNEALNGLRQAPSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYA APEGKAPANSPRQGNSKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTP AVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTV MFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVL VSADR


    Database link: P20393

  • Positive control

    • IHC-P: Human spleen and liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Functions as a constitutive transcriptional repressor. Possible receptor for triiodothyronine.
  • Tissue specificity

    Expressed in all tissues and cell lines examined. Expressed at high levels in some squamous carcinoma cell lines.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Domain

    Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • EAR-1 antibody
    • EAR1 antibody
    • ERBA-related 1 antibody
    • hRev antibody
    • Nr1d1 antibody
    • NR1D1_HUMAN antibody
    • Nuclear receptor Rev ErbA alpha antibody
    • Nuclear receptor subfamily 1 group D member 1 antibody
    • Rev erbAalpha antibody
    • Rev erbalpha antibody
    • Rev-erbA-alpha antibody
    • Rev-ErbAalpha antibody
    • Reverba antibody
    • THRA1 antibody
    • THRAL antibody
    • Thyroid hormone receptor, alpha like antibody
    • Thyroid hormone receptor, alpha-1- like antibody
    • V-erbA-related protein 1 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for NR1D1 using ab236086 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human spleen tissue stained for NR1D1 using ab236086 at 1/100 dilution in immunohistochemical analysis.

References

ab236086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up