Overview

  • Product name

    Anti-NR3B antibody [2A8E11]
    See all NR3B primary antibodies
  • Description

    Mouse monoclonal [2A8E11] to NR3B
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NR3B aa 135-276. Expressed in E.coli.
    Sequence:

    ARAPLGAPNPFHLQLHWASPLETLLDVLVAVLQAHAWEDVGLALCRTQDP GGLVALWTSRAGRPPQLVLDLSRRDTGDAGLRARLAPMAAPVGGEAPVPA AVLLGCDIARARRVLEAVPPGPHWLLGTPLPPKALPTAGLPP


    Database link: O60391

  • Positive control

    • WB: Recombinant human NR3B (aa135-276) protein; NR3B (aa135-276)-IgG-Fc-transfected HEK-293 cell lysate. Flow cyt: SH-SY5Y and SK-N-SH cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    2A8E11
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    NMDA receptor subtype of glutamate-gated ion channels with reduced single-channel conductance, low calcium permeability and low voltage-dependent sensitivity to magnesium. Mediated by glycine.
  • Sequence similarities

    Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. NR3B/GRIN3B subfamily.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane. Requires the presence of GRIN1 to be targeted at the plasma membrane.
  • Information by UniProt
  • Database links

  • Form

    A subunit of the N-methyl-D-aspartate (NMDA) receptor, which belongs to the superfamily of glutamate-regulated ion channels that are present in neurons throughout the central nervous system.
  • Alternative names

    • GluN3B antibody
    • Glutamate [NMDA] receptor subunit 3B antibody
    • Glutamate receptor ionotropic N methyl D aspartate 3B antibody
    • Glutamate receptor ionotropic NMDA 3B antibody
    • GRIN3B antibody
    • N-methyl-D-aspartate receptor subtype 3B antibody
    • NMD3B_HUMAN antibody
    • NMDA receptor subunit 3B antibody
    • NMDA type glutamate receptor subunit NR3B antibody
    • NMDAR3B antibody
    • NR3B antibody
    see all

Images

  • Anti-NR3B antibody [2A8E11] (ab233708) at 1/500 dilution + Recombinant human NR3B (aa135-276) protein

    Developed using the ECL technique.
  • All lanes : Anti-NR3B antibody [2A8E11] (ab233708) at 1/500 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Human NR3B (aa135-276) IgG-Fc- transfected HEK-293 cell lysate

    Developed using the ECL technique.
  • Flow cytometric analysis of SH-SY5Y (human neuroblastoma cell line from bone marrow) cells labeling NR3B with ab233708 at 1/200 dilution (green) compared with a negative control (red).

  • Flow cytometric analysis of SK-N-SH (human neuroblastoma cell line) cells labeling NR3B with ab233708 at 1/200 dilution (green) compared with a negative control (red).

References

ab233708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up