Overview

  • Product name

    Anti-NR5A2 / LRH1 antibody - C-terminal
    See all NR5A2 / LRH1 primary antibodies
  • Description

    Rabbit polyclonal to NR5A2 / LRH1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NR5A2/ LRH1 aa 252-541 (C terminal).
    Sequence:

    HGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASI PHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQ TLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEG SIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCL KFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLL RLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA


    Database link: O00482

  • Positive control

    • MCF7, 293T, HeLa, Mouse liver and Rat liver extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 61 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. May be responsible for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. Key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. May also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.
  • Tissue specificity

    Abundantly expressed in pancreas, less in liver, very low levels in heart and lung. Expressed in the Hep-G2 cell line. Isoform 1 and isoform 2 seem to be present in fetal and adult liver and Hep-G2 cells.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR5 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha-1-fetoprotein transcription factor antibody
    • B1-binding factor antibody
    • B1F antibody
    • B1F2 antibody
    • CPF antibody
    • CYP7A promoter-binding factor antibody
    • FTF antibody
    • FTZ F1 antibody
    • FTZ F1beta antibody
    • FTZ-F1 antibody
    • FTZ-F1beta antibody
    • hB1F 2 antibody
    • hB1F antibody
    • hB1F-2 antibody
    • Hepatocytic transcription factor antibody
    • Liver receptor homolog 1 antibody
    • LRH-1 antibody
    • LRH1 antibody
    • Nr5a2 antibody
    • NR5A2_HUMAN antibody
    • Nuclear receptor subfamily 5 group A member 2 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of A549 cells using ab189876. Blue DAPI for nuclear staining.
  • All lanes : Anti-NR5A2 / LRH1 antibody - C-terminal (ab189876) at 1/500 dilution

    Lane 1 : MCF7 cell line extract
    Lane 2 : 293T cell line extract
    Lane 3 : HeLa cell line extract
    Lane 4 : Mouse liver extract
    Lane 5 : Rat liver extract

    Predicted band size: 61 kDa

References

This product has been referenced in:

  • Liu Y  et al. LRH1 as a promising prognostic biomarker and predictor of metastasis in patients with non-small cell lung cancer. Thorac Cancer 9:1725-1732 (2018). Read more (PubMed: 30273983) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up