Overview

  • Product name
    Anti-NrCAM antibody [7D8C5]
    See all NrCAM primary antibodies
  • Description
    Mouse monoclonal [7D8C5] to NrCAM
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IF, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NrCAM aa 1192-1255. Expressed in E. coli.
    Sequence:

    RNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTP SDRTVKKEDSDDSL


    Database link: Q92823

  • Positive control
    • HepG2 cells; Human NrCAM recombinant protein; NrCAM (aa 1192-1255)-hIgGFc transfected HEK293 cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    0.5% protein stabilizer
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    Purified from tissue culture supernatant.
  • Clonality
    Monoclonal
  • Clone number
    7D8C5
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175366 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 144 kDa.
ICC/IF 1/50.
ELISA 1/10000.

Target

  • Function
    Cell adhesion, ankyrin-binding protein involved in neuron-neuron adhesion. May play a role in the molecular assembly of the nodes of Ranvier.
  • Tissue specificity
    Detected in all the examined tissues. In the brain it was detected in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family.
    Contains 5 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Bravo antibody
    • hBravo antibody
    • Neuronal cell adhesion molecule antibody
    • Neuronal surface protein Bravo antibody
    • Ng CAM related antibody
    • Ng-CAM-related antibody
    • NgCAM related cell adhesion molecule antibody
    • NgCAM-related cell adhesion molecule antibody
    • Nr CAM antibody
    • Nr-CAM antibody
    • Nrcam antibody
    • NRCAM_HUMAN antibody
    see all

Images

  • All lanes : Anti-NrCAM antibody [7D8C5] (ab175366) at 1/500 dilution

    Lane 1 : non transfected HEK293 cell lysate.
    Lane 2 : NrCAM (aa 1192-1255)-hIgGFc transfected HEK293 cell lysate.

    Predicted band size: 144 kDa



    Expected MW is 32.7 kDa

  • Anti-NrCAM antibody [7D8C5] (ab175366) at 1/500 dilution + Human NrCAM recombinant protein

    Predicted band size: 144 kDa



    Expected MW is 32.7 kDa

  • Immunofluorescent analysis of HepG2 cells labeling NrCAM using ab175366 at 1/50 dilution (green).

    Blue: DRAQ5 fluorescent DNA dye.

    Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

References

ab175366 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175366.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up