Overview

  • Product name

  • Description

    Rabbit polyclonal to NRG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human NRG2 aa 483-583.
    Sequence:

    HVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSD SQSGIMLSSVGTSKCNSPACVEARARRAAAYNLEERRRATAPPYHDSVDS L


    Database link: O14511

  • Positive control

    • Human cerebellum tissue; RT-4, U251 MG, human liver and tonsil lysates; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100
WB 1/50 - 1/200. Predicted molecular weight: 92 kDa.

Target

  • Function

    Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
  • Tissue specificity

    Restricted to the cerebellum in the adult.
  • Sequence similarities

    Belongs to the neuregulin family.
    Contains 1 EGF-like domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain

    The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization.
    ERBB receptor binding is elicited entirely by the EGF-like domain.
  • Post-translational
    modifications

    Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
    Extensive glycosylation precedes the proteolytic cleavage.
  • Cellular localization

    Secreted and Cell membrane. Does not seem to be active.
  • Information by UniProt
  • Database links

  • Alternative names

    • Divergent of neuregulin 1 antibody
    • Divergent of neuregulin-1 antibody
    • Don 1 antibody
    • DON-1 antibody
    • Neural- and thymus-derived activator for ERBB kinases antibody
    • Neuregulin 2 antibody
    • Neuregulin-2 antibody
    • NRG-2 antibody
    • Nrg2 antibody
    • NRG2_HUMAN antibody
    • NTAK antibody
    • Pro NRG2 antibody
    • Pro-NRG2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human cerebellum tissue labeling NRG2 with ab220615 at 1/50 dilution.

  • Immunofluorescent analysis of PFAfixed, Triton X-100 permeabilized U-2 OS cells labeling NRG2 with ab220615 at 4 μg/ml (green).

  • All lanes : Anti-NRG2 antibody (ab220615) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 92 kDa

References

ab220615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up