Overview

  • Product name

    Anti-NRG4 antibody [C2]
    See all NRG4 primary antibodies
  • Description

    Mouse monoclonal [C2] to NRG4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NRG4 aa 1-62. Two N-terminal Tags, His-tag and GST-tag. Expressed in E. coli.
    Sequence:

    MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFL PGSSIQTKSNLF


    Database link: Q8WWG1

  • Positive control

    • WB: Recombinant human NRG4 protein; HepG2 cell lysate. IHC-P: Human lung cancer, brain and stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Function

    Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and ERBB3 receptors.
  • Sequence similarities

    Belongs to the neuregulin family.
    Contains 1 EGF-like domain.
  • Domain

    The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization.
    ERBB receptor binding is elicited entirely by the EGF-like domain.
  • Post-translational
    modifications

    Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
    Extensive glycosylation precedes the proteolytic cleavage.
  • Cellular localization

    Secreted and Cell membrane. Does not seem to be active.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp779N0541 antibody
    • DKFZp779N1944 antibody
    • Heregulin 4 antibody
    • HRG4 antibody
    • Neuregulin 4 antibody
    • Neuregulin-4 antibody
    • NRG-4 antibody
    • NRG4 antibody
    • NRG4_HUMAN antibody
    • pro-neuregulin-4, membrane-bound isoform antibody
    • Pro-NRG4 antibody
    see all

Images

  • Anti-NRG4 antibody [C2] (ab239580) at 5 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    HRP-Goat Anti-Mouse IgG at 0.2 µg/ml
  • Paraffin-embedded human brain tissue stained for NRG4 using ab239580 at 20 μg/mL in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for NRG4 using ab239580 at 20 μg/mL in immunohistochemical analysis.

  • Paraffin-embedded human stomach tissue stained for NRG4 using ab239580 at 20 μg/mL in immunohistochemical analysis.

  • Anti-NRG4 antibody [C2] (ab239580) at 2 µg/ml + Recombinant human NRG4 protein

References

ab239580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up