Overview

  • Product name

    Anti-Nrip2 antibody
  • Description

    Rabbit polyclonal to Nrip2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Nrip2 aa 1-281.
    Sequence:

    MLFIFPLSLPWRPSCWKESCSTGQRQAGRSREDSVTPPPSSPWPTPPAGA MSTKQEARRDEGEARTRGQEAQLRDRAHLSQQRRLKQATQFLHKDSADLL PLDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQDLIHGQESRR KTSRTEIPALLVNCKCQDQLLRVAVDTGTQYNRISAGCLSRLGLEKRVLK ASAGDLAPGPPTQVEQLELQLGQETVVCSAQVVDAESPEFCLGLQTLLSL KCCIDLEHGVLRLKAPFSELPFLPLYQEPGQ


    Database link: Q9BQI9

  • Positive control

    • IHC-P: Human colon cancer tissue. WB: Rat heart lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab235405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/3000. Predicted molecular weight: 31 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Down-regulates transcriptional activation by nuclear receptors such as NR1F2.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp761G1913; antibody
    • Neuronal interacting factor X 1 antibody
    • Nix1 antibody
    • Nrip2 antibody
    • NRIP2_HUMAN antibody
    • Nuclear receptor interacting protein 2 antibody
    • Nuclear receptor-interacting protein 2 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for Nrip2 using ab235405 at 1/100 dilution in immunohistochemical analysis.

  • Anti-Nrip2 antibody (ab235405) at 1/200 dilution + Rat heart lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 31 kDa

References

ab235405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up